Shopping Cart
- Remove All
Your shopping cart is currently empty
Channel that opens in response to stretch forces in the membrane lipid bilayer. May participate in the regulation of osmotic pressure changes within the cell. MscL Protein, E. coli O157:H7, Recombinant (B2M & His) is expressed in E. coli expression system with N-6xHis-B2M tag. The predicted molecular weight is 29.0 kDa and the accession number is P0A743.

| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 5 μg | $129 | 20 days | |
| 10 μg | $216 | 20 days | |
| 20 μg | $360 | 20 days | |
| 50 μg | $543 | 20 days | |
| 100 μg | $745 | 20 days | |
| 200 μg | $1,070 | 20 days | |
| 500 μg | $1,730 | 20 days | |
| 1 mg | $2,530 | 20 days |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Channel that opens in response to stretch forces in the membrane lipid bilayer. May participate in the regulation of osmotic pressure changes within the cell. MscL Protein, E. coli O157:H7, Recombinant (B2M & His) is expressed in E. coli expression system with N-6xHis-B2M tag. The predicted molecular weight is 29.0 kDa and the accession number is P0A743. |
| Species | E. coli |
| Expression System | E. coli |
| Tag | N-6xHis-B2M |
| Accession Number | P0A743 |
| Synonyms | mscL,Large-conductance mechanosensitive channel |
| Amino Acid | MSIIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVTLRDAQGDIPAVVMHYGVFIQNVFDFLIVAFAIFMAIKLINKLNRKKEEPAAAPAPTKEEVLLTEIRDLLKEQNNRS |
| Construction | 1-136 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Molecular Weight | 29.0 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
| Research Background | Channel that opens in response to stretch forces in the membrane lipid bilayer. May participate in the regulation of osmotic pressure changes within the cell. |

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.