MMP-7 Protein, Rat, Recombinant (GST)

Catalog No. TMPH-03331 Copy Product Info

Degrades casein, gelatins of types I, III, IV, and V, and fibronectin. Activates procollagenase. MMP-7 Protein, Rat, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 45.9 kDa and the accession number is P50280.

MMP-7 Protein, Rat, Recombinant (GST)

Catalog No. TMPH-03331

Copy Product Info

Pack Size	Price	USA Stock	Global Stock
5 μg	$105	-	In Stock
10 μg	$169	20 days	20 days
20 μg	$283	-	In Stock
50 μg	$428	20 days	20 days
100 μg	$590	20 days	20 days
200 μg	$913	20 days	20 days
500 μg	$1,620	20 days	20 days
1 mg	$2,530	20 days	20 days

Add to Cart

Add to Quotation

For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Resource Download

COA User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Degrades casein, gelatins of types I, III, IV, and V, and fibronectin. Activates procollagenase. MMP-7 Protein, Rat, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 45.9 kDa and the accession number is P50280.
Species	Rat
Expression System	E. coli
Tag	N-GST
Accession Number	P50280
Synonyms	Uterine metalloproteinase,Pump-1 protease,Mmp-7,Mmp7,Matrix metalloproteinase-7 (MMP-7),Matrin,Matrilysin
Amino Acid	FSLMPNSPKWHSRTVTYRIVSYTTDLPRFLVDQIVKRALRMWSMQIPLNFKRVSWGTADIIIGFARGDHGDNFPFDGPGNTLGHAFAPGPGLGGDAHFDKDEYWTDGEDSGVNFLFVATHELGHSLGLGHSSVPSSVMYPTYQGDHSEDFSLTKDDIAGIQKLYGKRNKL
Construction	98-267 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	45.9 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background	Degrades casein, gelatins of types I, III, IV, and V, and fibronectin. Activates procollagenase.