MMP-7 Protein, Human, Recombinant (GST)

Name: MMP-7 Protein, Human, Recombinant (GST)
Brand: TargetMol
SKU: TMPH-01644
Price: 75 USD
Availability: InStock
Rating: 5 (10 reviews)

(Synonyms: Uterine metalloproteinase, Pump-1 protease, PUMP1, MPSL1, MMP7, Matrix metalloproteinase-7 (MMP-7), Matrin, Matrilysin) Copy Product Info

Synonyms: Uterine metalloproteinase, Pump-1 protease, PUMP1, MPSL1, MMP7, Matrix metalloproteinase-7 (MMP-7), Matrin, Matrilysin

Catalog No. TMPH-01644 Copy Product Info

Degrades casein, gelatins of types I, III, IV, and V, and fibronectin. Activates procollagenase. MMP-7 Protein, Human, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 46.1 kDa and the accession number is P09237.

Pack Size	Price	USA Stock	Global Stock
5 µg	$75	-	In Stock
10 µg	$119	20 days	20 days
20 µg	$198	-	In Stock
50 µg	$297	20 days	20 days
100 µg	$427	20 days	20 days
200 µg	$658	20 days	20 days
500 µg	$1,170	20 days	20 days
1 mg	$1,830	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:90%

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Degrades casein, gelatins of types I, III, IV, and V, and fibronectin. Activates procollagenase. MMP-7 Protein, Human, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 46.1 kDa and the accession number is P09237.
Species	Human
Expression System	E. coli
Tag	N-GST
Accession Number	P09237
Amino Acid	YSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK
Construction	95-267 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Uterine metalloproteinase, Pump-1 protease, PUMP1, MPSL1, MMP7, Matrix metalloproteinase-7 (MMP-7), Matrin, Matrilysin
Research Background	Degrades casein, gelatins of types I, III, IV, and V, and fibronectin. Activates procollagenase.

Chemical Properties

Molecular Weight

46.1 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.