Shopping Cart
- Remove All
Your shopping cart is currently empty
MMP-25 Protein, Human, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is Q9NPA2.

| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 20 μg | $283 | 20 days | |
| 100 μg | $537 | 20 days | |
| 1 mg | $2,300 | 20 days |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. |
| Description | MMP-25 Protein, Human, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is Q9NPA2. |
| Species | Human |
| Expression System | E. coli |
| Tag | C-6xHis |
| Accession Number | Q9NPA2 |
| Synonyms | MT6MMP,MMPL1,MMP-25,MMP25,MMP20,Membrane-type-6 matrix metalloproteinase (MT6-MMP;MT6MMP),Membrane-type matrix metalloproteinase 6 (MT-MMP 6;MTMMP6),Matrix metalloproteinase-25,Leukolysin |
| Amino Acid | YALSGSVWKKRTLTWRVRSFPQSSQLSQETVRVLMSYALMAWGMESGLTFHEVDSPQGQEPDILIDFARAFHQDSYPFDGLGGTLAHAFFPGEHPISGDTHFDDEETWTFGSKDGEGTDLFAVAVHEFGHALGLGHSSAPNSIMRPFYQGPVGDPDKYRLSQDDRDGLQQLYGKAPQTPYDKPTRKPLAPPPQPPASPTHSPSFPIPDRCEGNFDAIANIRGETFFFKGPWFWRLQPSGQLVSPRPARLHRFWEGLPAQVRVVQAAYARHRDGRILLFSGPQFWVFQDRQLEGGARPLTELGLPPGEEVDAVFSWPQNGKTYLVRGRQYWRYDEAAARPDPGYPRDLSLWEGAPPSPDDVTVSNAGDTYFFKGAHYWRFPKNSIKTEPDAPQPMGPNWLDCPAPSSGPRAPRPPKATPVSETCDCQCELNQA |
| Construction | 108-539 aa |
| Protein Purity | >95% as determined by SDS-PAGE. |
| Molecular Weight | 55.2 kDa (Predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.