MEGF6 Protein, Human, Recombinant (His)

Name: MEGF6 Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-04022
Rating: 4.5 (1 reviews)

(Synonyms: Multiple epidermal growth factor-like domains protein 6, Multiple EGF-like domains protein 6, MEGF6, KIAA0815, Epidermal growth factor-like protein 3 (EGF-like protein 3), EGFL3) Copy Product Info

Synonyms: Multiple epidermal growth factor-like domains protein 6, Multiple EGF-like domains protein 6, MEGF6, KIAA0815, Epidermal growth factor-like protein 3 (EGF-like protein 3), EGFL3

Catalog No. TMPH-04022 Copy Product Info

MEGF6 Protein, Human, Recombinant (His) is expressed in E. coli with N-6xHis. The accession number is O75095.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 μg	$98	20 days	20 days
10 μg	$169	20 days	20 days
20 μg	$283	20 days	20 days
50 μg	$397	20 days	20 days
100 μg	$537	20 days	20 days
200 μg	$828	20 days	20 days
500 μg	$1,480	20 days	20 days
1 mg	$2,300	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description	MEGF6 Protein, Human, Recombinant (His) is expressed in E. coli with N-6xHis. The accession number is O75095.
Species	Human
Expression System	E. coli
Tag	N-6xHis
Accession Number	O75095
Amino Acid	CRTHNGGCQHRCVNTPGSYLCECKPGFRLHTDSRTCLAINSCALGNGGCQHHCVQLTITRHRCQCRPGFQLQEDGRHCVRRSPCANRNGSCMHRCQVVRGLARCECHVGYQLAADGKACEDVDECAAGLAQCAHGCLNTQGSFKCVCHAGYELGADGRQCYRIEMEIVNSCEANNGGCSHGCSHTSAGPLCTCPRGYELDTDQRTC
Construction	165-370 aa
Protein Purity	>85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	Multiple epidermal growth factor-like domains protein 6, Multiple EGF-like domains protein 6, MEGF6, KIAA0815, Epidermal growth factor-like protein 3 (EGF-like protein 3), EGFL3

Chemical Properties

Molecular Weight

26.4 kDa (Predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

MEGF 6KIAA 0815EGF-likeprotein3EGF-like protein 3EGFL 3

Related Tags: MEGF6 Protein, Human, Recombinant (His) chemical structure | MEGF6 Protein, Human, Recombinant (His) molecular weight