Home Tools
Log in
Cart

LZ-8 Protein, Ganoderma lucidum, Recombinant (His & Myc)

Catalog No. TMPH-00766

LZ-8 Protein, Ganoderma lucidum, Recombinant (His & Myc) is expressed in E. coli with N-terminal 10xHis tag and C-terminal Myc tag. The predicted molecular weight is 19.8 kDa. Accession number: P14945

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
LZ-8 Protein, Ganoderma lucidum, Recombinant (His & Myc)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 360.00
100 μg 20 days $ 678.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Technical Params
Product Properties
Description LZ-8 Protein, Ganoderma lucidum, Recombinant (His & Myc) is expressed in E. coli with N-terminal 10xHis tag and C-terminal Myc tag. The predicted molecular weight is 19.8 kDa. Accession number: P14945
Species Ganoderma lucidum
Expression System E. coli
Tag N-terminal 10xHis-tagged and C-terminal Myc-tagged
Accession Number P14945
Amino Acid SDTALIFRLAWDVKKLSFDYTPNWGRGNPNNFIDTVTFPKVLTDKAYTYRVAVSGRNLGVKPSYAVESDGSQKVNFLEYNSGYGIADTNTIQVFVVDPDTNNDFIIAQWN Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Construction 2-111 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 19.8 kDa (predicted)
Formulation If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage

Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shipping

In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

recombinant recombinant-proteins proteins protein

 

TargetMol