Shopping Cart
Remove All
Your shopping cart is currently empty
LY6E Protein, Human, Recombinant (hFc)
Catalog No. TMPH-04614 Copy Product Info
LY6E Protein, Human, Recombinant (hFc) is expressed in Mammalian cell. The accession number is Q16553.
LY6E Protein, Human, Recombinant (hFc)
Catalog No. TMPH-04614
Copy Product InfoLY6E Protein, Human, Recombinant (hFc) is expressed in Mammalian cell. The accession number is Q16553.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $98 | 20 days | 20 days | |
| 10 μg | $159 | 20 days | 20 days | |
| 20 μg | $266 | 20 days | 20 days | |
| 50 μg | $365 | 20 days | 20 days | |
| 100 μg | $465 | 20 days | 20 days | |
| 200 μg | $833 | 20 days | 20 days | |
| 500 μg | $1,790 | 20 days | 20 days | |
| 1 mg | $3,280 | 20 days | 20 days |
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Batch Information
Resource Download
Product Information
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | LY6E Protein, Human, Recombinant (hFc) is expressed in Mammalian cell. The accession number is Q16553. |
| Species | Human |
| Expression System | HEK293 Cells |
| Tag | N-hFc |
| Accession Number | Q16553 |
| Synonyms | TSA1,Thymic shared antigen 1 (TSA-1),Stem cell antigen 2 (SCA-2),SCA2,RIGE,Retinoic acid-induced gene E protein (RIG-E),Lymphocyte antigen 6E,Ly-6E,LY6E,9804 |
| Amino Acid | LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFS |
| Construction | 21-101 aa |
| Protein Purity | > 95% as determined by SDS-PAGE. |
| Molecular Weight | 34.5 kDa (Predicted) |
| Endotoxin | Not tested. |
| Formulation | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 251 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
Dose Conversion
You can also refer to dose conversion for different animals. More
Calculator
Tech Support
Please read the User Guide of Recombinant Proteins for more specific information.
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.