Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

LolA Protein, K. pneumoniae, Recombinant (His)

TargetMol | SPR
Catalog No. TMPH-04534

LolA Protein, K. pneumoniae, Recombinant (His) is expressed in Yeast. The accession number is B5XYA1.

LolA Protein, K. pneumoniae, Recombinant (His)

LolA Protein, K. pneumoniae, Recombinant (His)

TargetMol | SPR
Catalog No. TMPH-04534
LolA Protein, K. pneumoniae, Recombinant (His) is expressed in Yeast. The accession number is B5XYA1.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$16320 days20 days
10 μg$26820 days20 days
20 μg$45220 days20 days
50 μg$64820 days20 days
100 μg$85720 days20 days
200 μg$1,23020 days20 days
500 μg$1,98020 days20 days
1 mg$2,97020 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
LolA Protein, K. pneumoniae, Recombinant (His) is expressed in Yeast. The accession number is B5XYA1.
Species
Klebsiella pneumoniae (strain 342)
Expression System
P. pastoris (Yeast)
TagC-6xHis
Accession NumberB5XYA1
Synonyms
Outer-membrane lipoprotein carrier protein,lolA
Amino Acid
DAASDLKSRLDKVSSFHASFTQKVTDGSGNAVQDGQGDLWVKRPNLFNWHMTQPDESVLVSDGKTLWFYNPFVEQATATWLKDATSNTPFMLIARNQSSDWQQYNIKQNGDDFVLTPKSGSGNLKQFTINVGRDGTIHQFSAVEQDDQRSSYQLKSQQNGAVDASKFTFTPPKGVTVDDQRK
Construction
22-203 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight22.1 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 171 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.