Lipocalin-2/LCN2 Protein, Human, Recombinant

Name: Lipocalin-2/LCN2 Protein, Human, Recombinant
Brand: TargetMol
SKU: TMPH-04037
Price: 1545 USD
Availability: InStock
Rating: 5 (10 reviews)

(Synonyms: Siderocalin, p25, Oncogene 24p3, NGAL, Neutrophil gelatinase-associated lipocalin, Lipocalin-2, LCN2, HNL, 25 kDa alpha-2-microglobulin-related subunit of MMP-9) Copy Product Info

Synonyms: Siderocalin, p25, Oncogene 24p3, NGAL, Neutrophil gelatinase-associated lipocalin, Lipocalin-2, LCN2, HNL, 25 kDa alpha-2-microglobulin-related subunit of MMP-9

Catalog No. TMPH-04037 Copy Product Info

Lipocalin-2/LCN2 Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is P80188.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$223	-	In Stock
10 µg	$368	-	In Stock
20 µg	$559	7-10 days	7-10 days
50 µg	$967	7-10 days	7-10 days
100 µg	$1,545	7-10 days	7-10 days
200 µg	Inquiry	7-10 days	7-10 days
500 µg	Inquiry	7-10 days	7-10 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:>95% as determined by SDS-PAGE.

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 0.5 ng/ml, corresponding to a specific activity of ＞ 2.0 × 106 IU/mg.
Description	Lipocalin-2/LCN2 Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is P80188.
Species	Human
Expression System	E. coli
Tag	Tag Free
Accession Number	P80188
Amino Acid	QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG
Construction	21-198 aa
Protein Purity	>95% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a 0.2 μm filtered PBS, pH 7.4, with 0.05 % Tween-20
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Siderocalin, p25, Oncogene 24p3, NGAL, Neutrophil gelatinase-associated lipocalin, Lipocalin-2, LCN2, HNL, 25 kDa alpha-2-microglobulin-related subunit of MMP-9

Chemical Properties

Molecular Weight

20.5 kDa (Predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.