Shopping Cart
Remove All
Your shopping cart is currently empty
Lipocalin-2/LCN2 Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is P80188.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 μg | $223 | 7-10 days | 7-10 days | |
| 10 μg | $368 | 7-10 days | 7-10 days | |
| 20 μg | $559 | 7-10 days | 7-10 days | |
| 50 μg | $967 | 7-10 days | 7-10 days | |
| 100 μg | $1,545 | 7-10 days | 7-10 days | |
| 200 μg | Inquiry | 7-10 days | 7-10 days | |
| 500 μg | Inquiry | 7-10 days | 7-10 days |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 106 IU/mg. |
| Description | Lipocalin-2/LCN2 Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is P80188. |
| Species | Human |
| Expression System | E. coli |
| Tag | Tag Free |
| Accession Number | P80188 |
| Synonyms | Siderocalin,p25,Oncogene 24p3,NGAL,Neutrophil gelatinase-associated lipocalin,Lipocalin-2,LCN2,HNL,25 kDa alpha-2-microglobulin-related subunit of MMP-9 |
| Amino Acid | QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG |
| Construction | 21-198 aa |
| Protein Purity | >95% as determined by SDS-PAGE. |
| Molecular Weight | 20.5 kDa (Predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a 0.2 μm filtered PBS, pH 7.4, with 0.05 % Tween-20 |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.