Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

LILRB3 Protein, Mouse, Recombinant (aa 25-642, His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-02757 Copy Product Info
May act as receptor for class I MHC antigens. Becomes activated upon coligation of LILRB3 and immune receptors, such as FCGR2B and the B-cell receptor. Down-regulates antigen-induced B-cell activation by recruiting phosphatases to its immunoreceptor tyrosine-based inhibitor motifs (ITIM). LILRB3 Protein, Mouse, Recombinant (aa 25-642, His) is expressed in HEK293 mammalian cells with C-6xHis tag. The predicted molecular weight is 70.8 kDa and the accession number is P97484.

LILRB3 Protein, Mouse, Recombinant (aa 25-642, His)

Catalog No. TMPH-02757
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

May act as receptor for class I MHC antigens. Becomes activated upon coligation of LILRB3 and immune receptors, such as FCGR2B and the B-cell receptor. Down-regulates antigen-induced B-cell activation by recruiting phosphatases to its immunoreceptor tyrosine-based inhibitor motifs (ITIM). LILRB3 Protein, Mouse, Recombinant (aa 25-642, His) is expressed in HEK293 mammalian cells with C-6xHis tag. The predicted molecular weight is 70.8 kDa and the accession number is P97484.

LILRB3 Protein, Mouse, Recombinant (aa 25-642, His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$19720 days20 days
10 μg$32720 days20 days
20 μg$54920 days20 days
50 μg$98720 days20 days
100 μg$1,69020 days20 days
200 μg$2,58020 days20 days
500 μg$4,53020 days20 days
1 mg$6,97020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
May act as receptor for class I MHC antigens. Becomes activated upon coligation of LILRB3 and immune receptors, such as FCGR2B and the B-cell receptor. Down-regulates antigen-induced B-cell activation by recruiting phosphatases to its immunoreceptor tyrosine-based inhibitor motifs (ITIM). LILRB3 Protein, Mouse, Recombinant (aa 25-642, His) is expressed in HEK293 mammalian cells with C-6xHis tag. The predicted molecular weight is 70.8 kDa and the accession number is P97484.
Species
Mouse
Expression System
HEK293 Cells
TagC-6xHis
Accession NumberP97484
Synonyms
PIR-B,Pirb,Paired immunoglobulin-like receptor B,Lilrb3,Leukocyte immunoglobulin-like receptor subfamily B member 3 (LIR-3;Leukocyte immunoglobulin-like receptor 3),Cell-surface glycoprotein p91
Amino Acid
SLPKPILRVQPDSVVSRRTKVTFLCEETIGANEYRLYKDGKLYKTVTKNKQKPENKAEFSFSNVDLSNAGQYRCSYSTQYKSSGYSDLLELVVTGHYWTPSLLAQASPVVTSGGYVTLQCESWHNDHKFILTVEGPQKLSWTQDSQYNYSTRKYHALFSVGPVTPNQRWICRCYSYDRNRPYVWSPPSESVELLVSGNLQKPTIKAEPGSVITSKRAMTIWCQGNLDAEVYFLHNEKSQKTQSTQTLQEPGNKGKFFIPSVTLQHAGQYRCYCYGSAGWSQPSDTLELVVTGIYEYYEPRLSVLPSPVVTAGGNMTLHCASDFPYDKFILTKEDKKFGNSLDTEHISSSGQYRALFIIGPTTPTHTGAFRCYGYYKNAPQLWSVPSALQQILISGLSKKPSLLTHQGHILDPGMTLTLQCFSDINYDRFALHKVGGADIMQHSSQQTDTGFSVANFTLGYVSSSTGGQYRCYGAHNLSSEWSASSEPLDILITGQLPLTPSLSVQPNHTVHSGETVSLLCWSMDSVDTFILSKEGSAQQPLRLKSKSHDQQSQAEFSMSAVTSHLSGTYRCYGAQDSSFYLLSSASAPVELTVSGPIETSTPPPTMSMPLGGLHMYLK
Construction
25-642 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight70.8 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
May act as receptor for class I MHC antigens. Becomes activated upon coligation of LILRB3 and immune receptors, such as FCGR2B and the B-cell receptor. Down-regulates antigen-induced B-cell activation by recruiting phosphatases to its immunoreceptor tyrosine-based inhibitor motifs (ITIM).

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords