Shopping Cart
Remove All
Your shopping cart is currently empty
LILRB3 Protein, Mouse, Recombinant (aa 25-642, His)
(Synonyms: PIR-B, Pirb, Paired immunoglobulin-like receptor B, Lilrb3, Leukocyte immunoglobulin-like receptor subfamily B member 3 (LIR-3;Leukocyte immunoglobulin-like receptor 3), Cell-surface glycoprotein p91) Copy Product InfoSynonyms: PIR-B, Pirb, Paired immunoglobulin-like receptor B, Lilrb3, Leukocyte immunoglobulin-like receptor subfamily B member 3 (LIR-3;Leukocyte immunoglobulin-like receptor 3), Cell-surface glycoprotein p91
Catalog No. TMPH-02757 Copy Product Info
May act as receptor for class I MHC antigens. Becomes activated upon coligation of LILRB3 and immune receptors, such as FCGR2B and the B-cell receptor. Down-regulates antigen-induced B-cell activation by recruiting phosphatases to its immunoreceptor tyrosine-based inhibitor motifs (ITIM). LILRB3 Protein, Mouse, Recombinant (aa 25-642, His) is expressed in HEK293 mammalian cells with C-6xHis tag. The predicted molecular weight is 70.8 kDa and the accession number is P97484.
Customer service consultation
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 µg | $197 | 20 days | 20 days | |
| 10 µg | $327 | 20 days | 20 days | |
| 20 µg | $549 | 20 days | 20 days | |
| 50 µg | $987 | 20 days | 20 days | |
| 100 µg | $1,690 | 20 days | 20 days | |
| 200 µg | $2,580 | 20 days | 20 days | |
| 500 µg | $4,530 | 20 days | 20 days | |
| 1 mg | $6,970 | 20 days | 20 days |
For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
Add to Cart
Add to Quotation
For research use only—not for human use. No sales to individuals. Use as intended only.
Resource Download
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | May act as receptor for class I MHC antigens. Becomes activated upon coligation of LILRB3 and immune receptors, such as FCGR2B and the B-cell receptor. Down-regulates antigen-induced B-cell activation by recruiting phosphatases to its immunoreceptor tyrosine-based inhibitor motifs (ITIM). LILRB3 Protein, Mouse, Recombinant (aa 25-642, His) is expressed in HEK293 mammalian cells with C-6xHis tag. The predicted molecular weight is 70.8 kDa and the accession number is P97484. |
| Species | Mouse |
| Expression System | HEK293 Cells |
| Tag | C-6xHis |
| Accession Number | P97484 |
| Amino Acid | SLPKPILRVQPDSVVSRRTKVTFLCEETIGANEYRLYKDGKLYKTVTKNKQKPENKAEFSFSNVDLSNAGQYRCSYSTQYKSSGYSDLLELVVTGHYWTPSLLAQASPVVTSGGYVTLQCESWHNDHKFILTVEGPQKLSWTQDSQYNYSTRKYHALFSVGPVTPNQRWICRCYSYDRNRPYVWSPPSESVELLVSGNLQKPTIKAEPGSVITSKRAMTIWCQGNLDAEVYFLHNEKSQKTQSTQTLQEPGNKGKFFIPSVTLQHAGQYRCYCYGSAGWSQPSDTLELVVTGIYEYYEPRLSVLPSPVVTAGGNMTLHCASDFPYDKFILTKEDKKFGNSLDTEHISSSGQYRALFIIGPTTPTHTGAFRCYGYYKNAPQLWSVPSALQQILISGLSKKPSLLTHQGHILDPGMTLTLQCFSDINYDRFALHKVGGADIMQHSSQQTDTGFSVANFTLGYVSSSTGGQYRCYGAHNLSSEWSASSEPLDILITGQLPLTPSLSVQPNHTVHSGETVSLLCWSMDSVDTFILSKEGSAQQPLRLKSKSHDQQSQAEFSMSAVTSHLSGTYRCYGAQDSSFYLLSSASAPVELTVSGPIETSTPPPTMSMPLGGLHMYLK |
| Construction | 25-642 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Synonyms | PIR-B, Pirb, Paired immunoglobulin-like receptor B, Lilrb3, Leukocyte immunoglobulin-like receptor subfamily B member 3 (LIR-3;Leukocyte immunoglobulin-like receptor 3), Cell-surface glycoprotein p91 |
| Research Background | May act as receptor for class I MHC antigens. Becomes activated upon coligation of LILRB3 and immune receptors, such as FCGR2B and the B-cell receptor. Down-regulates antigen-induced B-cell activation by recruiting phosphatases to its immunoreceptor tyrosine-based inhibitor motifs (ITIM). |
| Molecular Weight | 70.8 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
You can also refer to dose conversion for different animals. More Dose Conversion
Tech Support
Please see Recombinant Proteins
Preview
Related Tags: LILRB3 Protein, Mouse, Recombinant (aa 25-642, His) chemical structure | LILRB3 Protein, Mouse, Recombinant (aa 25-642, His) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.