LecA Protein, Pseudomonas aeruginosa, Recombinant (His)

Name: LecA Protein, Pseudomonas aeruginosa, Recombinant (His)
Brand: TargetMol
SKU: TMPH-03174
Rating: 4.5 (1 reviews)

(Synonyms: PA-IL, PA-I galactophilic lectin, pa1L, lecA, Galactose-binding lectin) Copy Product Info

Synonyms: PA-IL, PA-I galactophilic lectin, pa1L, lecA, Galactose-binding lectin

Catalog No. TMPH-03174 Copy Product Info

D-galactose specific lectin. Binds in decreasing order of affinity: melibiose, methyl-alpha-D-galactoside, D-galactose, methyl-beta-D-galactoside, N-acetyl-D-galactosamine. Similar to plant lectins in its selective (carbohydrate-specific) hemagglutinating activity. LecA Protein, Pseudomonas aeruginosa, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 16.8 kDa and the accession number is Q05097.

LecA Protein, Pseudomonas aeruginosa, Recombinant (His)

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$129	20 days	20 days
10 µg	$216	20 days	20 days
20 µg	$360	20 days	20 days
50 µg	$543	20 days	20 days
100 µg	$745	20 days	20 days
200 µg	$1,070	20 days	20 days
500 µg	$1,730	20 days	20 days
1 mg	$2,530	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	D-galactose specific lectin. Binds in decreasing order of affinity: melibiose, methyl-alpha-D-galactoside, D-galactose, methyl-beta-D-galactoside, N-acetyl-D-galactosamine. Similar to plant lectins in its selective (carbohydrate-specific) hemagglutinating activity. LecA Protein, Pseudomonas aeruginosa, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 16.8 kDa and the accession number is Q05097.
Species	Pseudomonas aeruginosa
Expression System	E. coli
Tag	N-6xHis
Accession Number	Q05097
Amino Acid	AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
Construction	2-122 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	PA-IL, PA-I galactophilic lectin, pa1L, lecA, Galactose-binding lectin
Research Background	D-galactose specific lectin. Binds in decreasing order of affinity: melibiose, methyl-alpha-D-galactoside, D-galactose, methyl-beta-D-galactoside, N-acetyl-D-galactosamine. Similar to plant lectins in its selective (carbohydrate-specific) hemagglutinating activity.

Chemical Properties

Molecular Weight

16.8 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Recombinant Proteins

Related Tags: LecA Protein, Pseudomonas aeruginosa, Recombinant (His) chemical structure | LecA Protein, Pseudomonas aeruginosa, Recombinant (His) molecular weight