Shopping Cart
Remove All
Your shopping cart is currently empty
KAAG1 Protein, Human, Recombinant (E. coli, His) is expressed in E. coli with C-6xHis. The accession number is Q9UBP8.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $129 | 20 days | 20 days | |
| 10 μg | $216 | 20 days | 20 days | |
| 20 μg | $360 | 20 days | 20 days | |
| 50 μg | $516 | 20 days | 20 days | |
| 100 μg | $678 | 20 days | 20 days | |
| 200 μg | $978 | 20 days | 20 days | |
| 500 μg | $1,590 | 20 days | 20 days | |
| 1 mg | $2,300 | 20 days | 20 days |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human KAAG1 at 2 μg/mL can bind Anti-KAAG1 recombinant antibody(CSB-RA871385MA1HU). The EC50 is 2.040-2.284 ng/mL. |
| Description | KAAG1 Protein, Human, Recombinant (E. coli, His) is expressed in E. coli with C-6xHis. The accession number is Q9UBP8. |
| Species | Human |
| Expression System | E. coli |
| Tag | C-6xHis |
| Accession Number | Q9UBP8 |
| Synonyms | RU2AS,RU2 antisense gene protein,Kidney-associated antigen 1,KAAG1 |
| Amino Acid | MDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREAPPLSQRPHRTQGAGSPPETNEKLTNPQVKEK |
| Construction | 1-84 aa |
| Protein Purity | >90% as determined by SDS-PAGE. |
| Molecular Weight | 15.9 kDa (Predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a 0.2 μm sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.