Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

KAAG1 Protein, Human, Recombinant (E. coli, His)

Copy Product Info
TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03989

KAAG1 Protein, Human, Recombinant (E. coli, His) is expressed in E. coli with C-6xHis. The accession number is Q9UBP8.

KAAG1 Protein, Human, Recombinant (E. coli, His)

KAAG1 Protein, Human, Recombinant (E. coli, His)

Copy Product Info
TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03989
KAAG1 Protein, Human, Recombinant (E. coli, His) is expressed in E. coli with C-6xHis. The accession number is Q9UBP8.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$12920 days20 days
10 μg$21620 days20 days
20 μg$36020 days20 days
50 μg$51620 days20 days
100 μg$67820 days20 days
200 μg$97820 days20 days
500 μg$1,59020 days20 days
1 mg$2,30020 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Human KAAG1 at 2 μg/mL can bind Anti-KAAG1 recombinant antibody(CSB-RA871385MA1HU). The EC50 is 2.040-2.284 ng/mL.
Description
KAAG1 Protein, Human, Recombinant (E. coli, His) is expressed in E. coli with C-6xHis. The accession number is Q9UBP8.
Species
Human
Expression System
E. coli
TagC-6xHis
Accession NumberQ9UBP8
Synonyms
RU2AS,RU2 antisense gene protein,Kidney-associated antigen 1,KAAG1
Amino Acid
MDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREAPPLSQRPHRTQGAGSPPETNEKLTNPQVKEK
Construction
1-84 aa
Protein Purity
>90% as determined by SDS-PAGE.
Molecular Weight15.9 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 μm sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords