K99 fimbrial Protein, E. coli, Recombinant

Catalog No. TMPH-00643

Fimbriae (also called pili), polar filaments radiating from the surface of the bacterium to a length of 0.5-1.5 micrometers and numbering 100-300 per cell, enable bacteria to colonize the epithelium of specific host organs.; FanC is the main component of the K99 fimbriae.

K99 fimbrial Protein, E. coli, Recombinant

Catalog No. TMPH-00643

Pack Size	Price	Availability
5 μg	$185	20 days
10 μg	$297	20 days
20 μg	$515	20 days
50 μg	$713	20 days
100 μg	$916	20 days
200 μg	$1,260	20 days
500 μg	$1,930	20 days
1 mg	$2,690	20 days

Bulk & Custom

Add to Cart

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Fimbriae (also called pili), polar filaments radiating from the surface of the bacterium to a length of 0.5-1.5 micrometers and numbering 100-300 per cell, enable bacteria to colonize the epithelium of specific host organs.; FanC is the main component of the K99 fimbriae.
Species	E. coli
Expression System	E. coli
Tag	Tag Free
Accession Number	P18103
Synonyms	K99 fimbrial protein,fanC
Amino Acid	NTGTINFNGKITSATCTIDPEVNGNRTSTIDLGQAAISGHGTVVDFKLKPAPGSNDCLAKTNARIDWSGSMNSLGFNNTASGNTAAKGYHMTLRATNVGNGSGGANINTSFTTAEYTHTSAIQSFNYSAQLKKDDRAPSNGGYKAGVFTTSASFLVTYM
Construction	23-181 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	16.5 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background	Fimbriae (also called pili), polar filaments radiating from the surface of the bacterium to a length of 0.5-1.5 micrometers and numbering 100-300 per cell, enable bacteria to colonize the epithelium of specific host organs.; FanC is the main component of the K99 fimbriae.