Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

IL12A & IL12B Heterodimer Protein, Human, Recombinant (Flag & His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-01518

IL12A & IL12B Heterodimer Protein, Human, Recombinant (Flag & His) is expressed in HEK293 mammalian cells with C-10xHis and C-Flag tag. The predicted molecular weight is 39.7 kDa and 27.2 kDa and the accession number is P29460 P29459.

IL12A & IL12B Heterodimer Protein, Human, Recombinant (Flag & His)

IL12A & IL12B Heterodimer Protein, Human, Recombinant (Flag & His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-01518
IL12A & IL12B Heterodimer Protein, Human, Recombinant (Flag & His) is expressed in HEK293 mammalian cells with C-10xHis and C-Flag tag. The predicted molecular weight is 39.7 kDa and 27.2 kDa and the accession number is P29460 P29459.
Pack SizePriceAvailabilityQuantity
5 μg$8920 days
10 μg$14320 days
20 μg$23720 days
50 μg$34320 days
100 μg$45720 days
200 μg$81820 days
500 μg$1,78020 days
1 mg$3,23020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Human IL12B & IL12A at 1 μg/mL can bind Anti-IL12/IL23 recombinant antibody, the EC50 is 1.042-1.545 ng/mL.
Description
IL12A & IL12B Heterodimer Protein, Human, Recombinant (Flag & His) is expressed in HEK293 mammalian cells with C-10xHis and C-Flag tag. The predicted molecular weight is 39.7 kDa and 27.2 kDa and the accession number is P29460 P29459.
Species
Human
Expression System
HEK293 Cells
TagC-10xHis,C-Flag
Accession NumberP29460 P29459
Amino Acid
IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS&RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
Construction
23-328 aa (IL12B) & 23-219 aa (IL12A)
Protein Purity
> 95% as determined by SDS-PAGE.
Molecular Weight39.7 kDa & 27.2 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a solution filtered through a 0.22 μm filter, containing 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.