Shopping Cart
Remove All
Your shopping cart is currently empty
IGF2R Protein, Bovine, Recombinant (hFc) is expressed in Mammalian cell. The accession number is P08169.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 μg | $54 | 20 days | 20 days | |
| 10 μg | $85 | 20 days | 20 days | |
| 20 μg | $138 | - | In Stock | |
| 50 μg | $235 | 20 days | 20 days | |
| 100 μg | $355 | 20 days | 20 days | |
| 200 μg | $619 | 20 days | 20 days | |
| 500 μg | $1,280 | 20 days | 20 days | |
| 1 mg | $2,290 | 20 days | 20 days |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | IGF2R Protein, Bovine, Recombinant (hFc) is expressed in Mammalian cell. The accession number is P08169. |
| Species | Bovine |
| Expression System | HEK293 Cells |
| Tag | C-hFc |
| Accession Number | P08169 |
| Synonyms | M6P,Insulin-like growth factor II receptor (IGF-II receptor),Insulin-like growth factor 2 receptor,IGF2R,CI Man-6-P receptor;CI-MPR;M6PR,CD222,Cation-independent mannose-6-phosphate receptor,300 kDa mannose 6-phosphate receptor (MPR 300) |
| Amino Acid | LSRTEGDNCTVFDSQAGFSFDLTPLTKKDAYKVETDKYEFHINVCGPVSVGACPPDSGACQVSRSDRKSWNLGRSNAKLSYYDGMIQLTYRDGTPYNNEKRTPRATLITFLCDRDAGVGFPEYQEEDNSTYNFRWYTSYACPEEP |
| Construction | 628-772 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Molecular Weight | 46.1 kDa (Predicted) |
| Endotoxin | Not tested. |
| Formulation | Lyophilized from PBS, 6% Trehalose, pH 7.4 |
| Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 415 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.