Shopping Cart
- Remove All
- Your shopping cart is currently empty
IGF2R Protein, Bovine, Recombinant (hFc) is expressed in Mammalian cell. The accession number is P08169.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 μg | $54 | 20 days | |
10 μg | $85 | 20 days | |
20 μg | $138 | 20 days | |
50 μg | $235 | 20 days | |
100 μg | $355 | 20 days | |
200 μg | $619 | 20 days | |
500 μg | $1,280 | 20 days | |
1 mg | $2,290 | 20 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | IGF2R Protein, Bovine, Recombinant (hFc) is expressed in Mammalian cell. The accession number is P08169. |
Species | Bovine |
Expression System | HEK293 Cells |
Tag | C-hFc |
Accession Number | P08169 |
Synonyms | M6P,Insulin-like growth factor II receptor (IGF-II receptor),Insulin-like growth factor 2 receptor,IGF2R,CI Man-6-P receptor;CI-MPR;M6PR,CD222,Cation-independent mannose-6-phosphate receptor,300 kDa mannose 6-phosphate receptor (MPR 300) |
Amino Acid | LSRTEGDNCTVFDSQAGFSFDLTPLTKKDAYKVETDKYEFHINVCGPVSVGACPPDSGACQVSRSDRKSWNLGRSNAKLSYYDGMIQLTYRDGTPYNNEKRTPRATLITFLCDRDAGVGFPEYQEEDNSTYNFRWYTSYACPEEP |
Construction | 628-772 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 46.1 kDa (Predicted) |
Endotoxin | Not tested. |
Formulation | Lyophilized from PBS, 6% Trehalose, pH 7.4 |
Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 415 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.