Shopping Cart
Remove All
Your shopping cart is currently empty
IGF2R Protein, Bovine, Recombinant (hFc)
(Synonyms: M6P, Insulin-like growth factor II receptor (IGF-II receptor), Insulin-like growth factor 2 receptor, IGF2R, CI Man-6-P receptor;CI-MPR;M6PR, CD222, Cation-independent mannose-6-phosphate receptor, 300 kDa mannose 6-phosphate receptor (MPR 300)) Copy Product InfoSynonyms: M6P, Insulin-like growth factor II receptor (IGF-II receptor), Insulin-like growth factor 2 receptor, IGF2R, CI Man-6-P receptor;CI-MPR;M6PR, CD222, Cation-independent mannose-6-phosphate receptor, 300 kDa mannose 6-phosphate receptor (MPR 300)
Catalog No. TMPH-04778 Copy Product Info
IGF2R Protein, Bovine, Recombinant (hFc) is expressed in Mammalian cell. The accession number is P08169.
Customer service consultation
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $54 | 20 days | 20 days | |
| 10 μg | $85 | 20 days | 20 days | |
| 20 μg | $138 | 20 days | 20 days | |
| 50 μg | $235 | 20 days | 20 days | |
| 100 μg | $355 | 20 days | 20 days | |
| 200 μg | $619 | 20 days | 20 days | |
| 500 μg | $1,280 | 20 days | 20 days | |
| 1 mg | $2,290 | 20 days | 20 days |
For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
Add to Cart
Add to Quotation
For research use only—not for human use. No sales to individuals. Use as intended only.
Batch Information
Select Batch
Purity:97% (SDS-PAGE)
Color:White
Contact us for more batch information
Resource Download
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Description | IGF2R Protein, Bovine, Recombinant (hFc) is expressed in Mammalian cell. The accession number is P08169. |
| Species | Bovine |
| Expression System | HEK293 Cells |
| Tag | C-hFc |
| Accession Number | P08169 |
| Amino Acid | LSRTEGDNCTVFDSQAGFSFDLTPLTKKDAYKVETDKYEFHINVCGPVSVGACPPDSGACQVSRSDRKSWNLGRSNAKLSYYDGMIQLTYRDGTPYNNEKRTPRATLITFLCDRDAGVGFPEYQEEDNSTYNFRWYTSYACPEEP |
| Construction | 628-772 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. https://cdn.targetmol.com/group3/M00/42/32/CgoaEWlM2rqEe74gAAAAAJuKrpM593.png |
| Endotoxin | Not tested. |
| Formulation | Lyophilized from PBS, 6% Trehalose, pH 7.4 |
| Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 415 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Synonyms | M6P, Insulin-like growth factor II receptor (IGF-II receptor), Insulin-like growth factor 2 receptor, IGF2R, CI Man-6-P receptor;CI-MPR;M6PR, CD222, Cation-independent mannose-6-phosphate receptor, 300 kDa mannose 6-phosphate receptor (MPR 300) |
| Molecular Weight | 46.1 kDa (Predicted) |
| Storage | Store at low temperature Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months |
Calculator
Dose Conversion
You can also refer to dose conversion for different animals. More Dose Conversion
Tech Support
Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc
Keywords
Preview
Related Tags: IGF2R Protein, Bovine, Recombinant (hFc) chemical structure | IGF2R Protein, Bovine, Recombinant (hFc) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.