IGF2R Protein, Bovine, Recombinant (hFc)

Catalog No. TMPH-04778 Copy Product Info

IGF2R Protein, Bovine, Recombinant (hFc) is expressed in Mammalian cell. The accession number is P08169.

IGF2R Protein, Bovine, Recombinant (hFc)

Catalog No. TMPH-04778

Copy Product Info

IGF2R Protein, Bovine, Recombinant (hFc) is expressed in Mammalian cell. The accession number is P08169.

Pack Size	Price	USA Stock	Global Stock
5 μg	$54	20 days	20 days
10 μg	$85	20 days	20 days
20 μg	$138	20 days	20 days
50 μg	$235	20 days	20 days
100 μg	$355	20 days	20 days
200 μg	$619	20 days	20 days
500 μg	$1,280	20 days	20 days
1 mg	$2,290	20 days	20 days

Add to Cart

Add to Quotation

For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Resource Download

COA User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	IGF2R Protein, Bovine, Recombinant (hFc) is expressed in Mammalian cell. The accession number is P08169.
Species	Bovine
Expression System	HEK293 Cells
Tag	C-hFc
Accession Number	P08169
Synonyms	M6P,Insulin-like growth factor II receptor (IGF-II receptor),Insulin-like growth factor 2 receptor,IGF2R,CI Man-6-P receptor;CI-MPR;M6PR,CD222,Cation-independent mannose-6-phosphate receptor,300 kDa mannose 6-phosphate receptor (MPR 300)
Amino Acid	LSRTEGDNCTVFDSQAGFSFDLTPLTKKDAYKVETDKYEFHINVCGPVSVGACPPDSGACQVSRSDRKSWNLGRSNAKLSYYDGMIQLTYRDGTPYNNEKRTPRATLITFLCDRDAGVGFPEYQEEDNSTYNFRWYTSYACPEEP
Construction	628-772 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	46.1 kDa (Predicted)
Endotoxin	Not tested.
Formulation	Lyophilized from PBS, 6% Trehalose, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 415 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.