Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

IGF2R Protein, Bovine, Recombinant (hFc)

TargetMol | SPR
Catalog No. TMPH-04778

IGF2R Protein, Bovine, Recombinant (hFc) is expressed in Mammalian cell. The accession number is P08169.

IGF2R Protein, Bovine, Recombinant (hFc)

IGF2R Protein, Bovine, Recombinant (hFc)

TargetMol | SPR
Catalog No. TMPH-04778
IGF2R Protein, Bovine, Recombinant (hFc) is expressed in Mammalian cell. The accession number is P08169.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$5420 days20 days
10 μg$8520 days20 days
20 μg$138-In Stock
50 μg$23520 days20 days
100 μg$35520 days20 days
200 μg$61920 days20 days
500 μg$1,28020 days20 days
1 mg$2,29020 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More
Select Batch

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
IGF2R Protein, Bovine, Recombinant (hFc) is expressed in Mammalian cell. The accession number is P08169.
Species
Bovine
Expression System
HEK293 Cells
TagC-hFc
Accession NumberP08169
Synonyms
M6P,Insulin-like growth factor II receptor (IGF-II receptor),Insulin-like growth factor 2 receptor,IGF2R,CI Man-6-P receptor;CI-MPR;M6PR,CD222,Cation-independent mannose-6-phosphate receptor,300 kDa mannose 6-phosphate receptor (MPR 300)
Amino Acid
LSRTEGDNCTVFDSQAGFSFDLTPLTKKDAYKVETDKYEFHINVCGPVSVGACPPDSGACQVSRSDRKSWNLGRSNAKLSYYDGMIQLTYRDGTPYNNEKRTPRATLITFLCDRDAGVGFPEYQEEDNSTYNFRWYTSYACPEEP
Construction
628-772 aa
Protein Purity
> 90% as determined by SDS-PAGE.
IGF2R Protein, Bovine, Recombinant (hFc)
Molecular Weight46.1 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 415 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords