Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

HWP1 Protein, Candida albicans, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-00337

HWP1 Protein, Candida albicans, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 24.2 kDa and the accession number is P46593.

HWP1 Protein, Candida albicans, Recombinant (His)

HWP1 Protein, Candida albicans, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-00337
HWP1 Protein, Candida albicans, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 24.2 kDa and the accession number is P46593.
Pack SizePriceAvailabilityQuantity
5 μg$12920 days
10 μg$21620 days
20 μg$36020 days
50 μg$54320 days
100 μg$74520 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
HWP1 Protein, Candida albicans, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 24.2 kDa and the accession number is P46593.
Species
Candida albicans
Expression System
E. coli
TagN-6xHis
Accession NumberP46593
Synonyms
Hyphal wall protein 1,HWP1,ECE2,Cell elongation protein 2
Amino Acid
GQGETEEALIQKRSYDYYQEPCDDYPQQQQQQEPCDYPQQQQQEEPCDYPQQQPQEPCDYPQQPQEPCDYPQQPQEPCDYPQQPQEPCDNPPQPDVPCDNPPQPDVPCDNPPQPDVPCDNPPQPDVPCDNPPQPDQPDDNPPIPNIPTDWIPNIPTDWIPDIPEKPTTPATTPNIPA
Construction
27-203 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight24.2 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Major hyphal cell wall protein which plays a role of adhesin and is required for mating, normal hyphal development, cell-to-cell adhesive functions necessary for biofilm integrity, attachment to host, and virulence. Promotes interactions with host and bacterial molecules, thus leading to effective colonization within polymicrobial communities. Plays a crucial role in gastrointestinal colonization, in mucosal symptomatic and asymptomatic infections, in vaginitis, as well as in lethal oroesophageal candidiasis, caused by the combined action of fungal virulence factors and host inflammatory responses when protective immunity is absent.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords