Shopping Cart
- Remove All
- Your shopping cart is currently empty
HWP1 Protein, Candida albicans, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 24.2 kDa and the accession number is P46593.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
20 μg | $360 | 20 days | |
100 μg | $745 | 20 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | HWP1 Protein, Candida albicans, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 24.2 kDa and the accession number is P46593. |
Species | Candida albicans |
Expression System | E. coli |
Tag | N-6xHis |
Accession Number | P46593 |
Synonyms | Hyphal wall protein 1,HWP1,ECE2,Cell elongation protein 2 |
Amino Acid | GQGETEEALIQKRSYDYYQEPCDDYPQQQQQQEPCDYPQQQQQEEPCDYPQQQPQEPCDYPQQPQEPCDYPQQPQEPCDYPQQPQEPCDNPPQPDVPCDNPPQPDVPCDNPPQPDVPCDNPPQPDVPCDNPPQPDQPDDNPPIPNIPTDWIPNIPTDWIPDIPEKPTTPATTPNIPA |
Construction | 27-203 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 24.2 kDa (predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | Tris-based buffer, 50% glycerol |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Major hyphal cell wall protein which plays a role of adhesin and is required for mating, normal hyphal development, cell-to-cell adhesive functions necessary for biofilm integrity, attachment to host, and virulence. Promotes interactions with host and bacterial molecules, thus leading to effective colonization within polymicrobial communities. Plays a crucial role in gastrointestinal colonization, in mucosal symptomatic and asymptomatic infections, in vaginitis, as well as in lethal oroesophageal candidiasis, caused by the combined action of fungal virulence factors and host inflammatory responses when protective immunity is absent. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.