Human cytomegalovirus (HCMV) (strain AD169) Uncharacterized protein UL128 (His)

Name: Human cytomegalovirus (HCMV) (strain AD169) Uncharacterized protein UL128 (His)
Brand: TargetMol
SKU: TMPH-01193
Rating: 4.5 (1 reviews)

(Synonyms: Uncharacterized protein UL128, UL128) Copy Product Info

Synonyms: Uncharacterized protein UL128, UL128

Catalog No. TMPH-01193 Copy Product Info

Human cytomegalovirus (HCMV) (strain AD169) Uncharacterized protein UL128 (His) is expressed in E. coli.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$129	20 days	20 days
10 µg	$216	20 days	20 days
20 µg	$360	20 days	20 days
50 µg	$543	20 days	20 days
100 µg	$745	20 days	20 days
200 µg	$1,070	20 days	20 days
500 µg	$1,730	20 days	20 days
1 mg	$2,530	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Appearance:Solution

Color:Transparent

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Human cytomegalovirus (HCMV) (strain AD169) Uncharacterized protein UL128 (His) is expressed in E. coli.
Species	HHV-5
Expression System	E. coli
Tag	N-6xHis
Accession Number	P16837
Amino Acid	MSPKDLTPFLTTLWLLLGHSRVPRVRAEECCEFINVNHPPERCYDFKMCNRFTVALRCPDGEVCYSPEKTAEIRGIVTTMTHSLTRQVVHNKLTSCNYNPLYLEADGRIRCGKVNDKAQYLLGAAGSVPYRWINLEYDKITRIVGLDQYLESVKKHKRLDVCRAKMGYMLQ
Construction	1-171 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	Uncharacterized protein UL128, UL128
Research Background	Plays a role in viral entry into host cells. Forms a pentameric complex at the surface of the viral envelope together with gH, gL, UL130 and UL131. This complex is required for entry in epithelial, endothelial and myeloid host cells. Mechanistically, engages host receptor(s) including neurophilin 2/NRP2 to mediate infection. Additionally, monomeric UL128 may interfere with certain inflammatory cytokines to increase infection and dissemination by blocking monocytes migration.

Chemical Properties

Molecular Weight

23.7 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Recombinant Proteins

Keywords

UL 128

Related Tags: Human cytomegalovirus (HCMV) (strain AD169) Uncharacterized protein UL128 (His) chemical structure | Human cytomegalovirus (HCMV) (strain AD169) Uncharacterized protein UL128 (His) molecular weight