Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Human cytomegalovirus (HCMV) (strain AD169) Uncharacterized protein UL128 (His)

Catalog No. TMPH-01193

Human cytomegalovirus (HCMV) (strain AD169) Uncharacterized protein UL128 (His) is expressed in E. coli.

Human cytomegalovirus (HCMV) (strain AD169) Uncharacterized protein UL128 (His)

Human cytomegalovirus (HCMV) (strain AD169) Uncharacterized protein UL128 (His)

Catalog No. TMPH-01193
Human cytomegalovirus (HCMV) (strain AD169) Uncharacterized protein UL128 (His) is expressed in E. coli.
Pack SizePriceAvailabilityQuantity
20 μg$36020 days
100 μg$74520 days
1 mg$2,53020 days
Bulk & Custom
Add to Cart
Questions
View More
Select Batch
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Human cytomegalovirus (HCMV) (strain AD169) Uncharacterized protein UL128 (His) is expressed in E. coli.
Species
HHV-5
Expression System
E. coli
TagN-6xHis
Accession NumberP16837
Synonyms
Uncharacterized protein UL128,UL128
Amino Acid
MSPKDLTPFLTTLWLLLGHSRVPRVRAEECCEFINVNHPPERCYDFKMCNRFTVALRCPDGEVCYSPEKTAEIRGIVTTMTHSLTRQVVHNKLTSCNYNPLYLEADGRIRCGKVNDKAQYLLGAAGSVPYRWINLEYDKITRIVGLDQYLESVKKHKRLDVCRAKMGYMLQ
Construction
1-171 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight23.7 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Plays a role in viral entry into host cells. Forms a pentameric complex at the surface of the viral envelope together with gH, gL, UL130 and UL131. This complex is required for entry in epithelial, endothelial and myeloid host cells. Mechanistically, engages host receptor(s) including neurophilin 2/NRP2 to mediate infection. Additionally, monomeric UL128 may interfere with certain inflammatory cytokines to increase infection and dissemination by blocking monocytes migration.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords