Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

HSPB6 Protein, Rat, Recombinant (His)

Catalog No. TMPH-04426

HSPB6 Protein, Rat, Recombinant (His) is expressed in E. coli. The accession number is P97541.

HSPB6 Protein, Rat, Recombinant (His)

HSPB6 Protein, Rat, Recombinant (His)

Catalog No. TMPH-04426
HSPB6 Protein, Rat, Recombinant (His) is expressed in E. coli. The accession number is P97541.
Pack SizePriceAvailabilityQuantity
20 μg $3177-10 days
100 μg $5887-10 days
1 mg $2,5507-10 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
HSPB6 Protein, Rat, Recombinant (His) is expressed in E. coli. The accession number is P97541.
Species
Rat
Expression System
E. coli
TagC-6xHis
Accession NumberP97541
Synonyms
HspB6,Hspb6,Heat shock protein beta-6,Heat shock 20 kDa-like protein p20 (Hsp20)
Amino Acid
MEIRVPVQPSWLRRASAPLPGFSTPGRLFDQRFGEGLLEAELASLCPAAIAPYYLRAPSVALPTAQVPTDPGYFSVLLDVKHFSPEEISVKVVGDHVEVHARHEERPDEHGFIAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQATPASAQASLPSPPAAK
Construction
1-162 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight24.4 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 63 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.