HSD11B1 Protein, Human, Recombinant (His & SUMO)

Catalog No. TMPH-00843 Copy Product Info

Catalyzes reversibly the conversion of cortisol to the inactive metabolite cortisone. Catalyzes reversibly the conversion of 7-ketocholesterol to 7-beta-hydroxycholesterol. In intact cells, the reaction runs only in one direction, from 7-ketocholesterol to 7-beta-hydroxycholesterol. HSD11B1 Protein, Human, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 45.5 kDa and the accession number is P28845.

HSD11B1 Protein, Human, Recombinant (His & SUMO)

Catalog No. TMPH-00843

Copy Product Info

HSD11B1 Protein, Human, Recombinant (His & SUMO)

Pack Size	Price	USA Stock	Global Stock
5 μg	$75	-	In Stock
10 μg	$119	-	In Stock
20 μg	$198	-	In Stock
50 μg	$297	-	In Stock
100 μg	$427	-	In Stock
200 μg	$658	20 days	20 days
500 μg	$1,170	20 days	20 days
1 mg	$1,830	20 days	20 days

Add to Cart

Add to Quotation

For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Resource Download

COA User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Catalyzes reversibly the conversion of cortisol to the inactive metabolite cortisone. Catalyzes reversibly the conversion of 7-ketocholesterol to 7-beta-hydroxycholesterol. In intact cells, the reaction runs only in one direction, from 7-ketocholesterol to 7-beta-hydroxycholesterol. HSD11B1 Protein, Human, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 45.5 kDa and the accession number is P28845.
Species	Human
Expression System	E. coli
Tag	N-6xHis-SUMO
Accession Number	P28845
Synonyms	Short chain dehydrogenase/reductase family 26C member 1,SDR26C1,HSD11L,HSD11B1,HSD11,Corticosteroid 11-beta-dehydrogenase isozyme 1,7-oxosteroid reductase,11-DH,11-beta-hydroxysteroid dehydrogenase 1,11-beta-HSD1
Amino Acid	EEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK
Construction	25-292 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	45.5 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background	Catalyzes reversibly the conversion of cortisol to the inactive metabolite cortisone. Catalyzes reversibly the conversion of 7-ketocholesterol to 7-beta-hydroxycholesterol. In intact cells, the reaction runs only in one direction, from 7-ketocholesterol to 7-beta-hydroxycholesterol.