Shopping Cart

Your shopping cart is currently empty

hpaA Protein, Helicobacter pylori, Recombinant (His)

Name: hpaA Protein, Helicobacter pylori, Recombinant (His)
Brand: TargetMol
SKU: TMPH-04717
Rating: 4.5 (1 reviews)

(Synonyms: Neuraminyllactose-binding hemagglutinin, N-acetylneuraminyllactose-binding fibrillar hemagglutinin receptor-binding subunit (NLBH), hpaA, Flagellar sheath adhesin) Copy Product Info

Synonyms: Neuraminyllactose-binding hemagglutinin, N-acetylneuraminyllactose-binding fibrillar hemagglutinin receptor-binding subunit (NLBH), hpaA, Flagellar sheath adhesin

Catalog No. TMPH-04717 Copy Product Info

hpaA Protein, Helicobacter pylori, Recombinant (His) is expressed in E. coli. The accession number is Q48254.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 μg	$116	20 days	20 days
10 μg	$189	20 days	20 days
20 μg	$317	20 days	20 days
50 μg	$448	20 days	20 days
100 μg	$588	20 days	20 days
200 μg	$913	20 days	20 days
500 μg	$1,630	20 days	20 days
1 mg	$2,550	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:Greater than 90% as determined by SDS-PAGE.

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	hpaA Protein, Helicobacter pylori, Recombinant (His) is expressed in E. coli. The accession number is Q48254.
Species	Helicobacter pylori (Campylobacter pylori)
Expression System	E. coli
Tag	C-6xHis
Accession Number	Q48254
Amino Acid	CSPHIIETNEVALKLNYHPASEKVQALDEKILLLRPAFQYSDNIAKEYENKFKNQTVLKVEQILQNQGYKVINVDSSDKDDFSFAQKKEGYLAVAMNGEIVLRPDPKRTIQKKSEPGLLFSTGLDKMEGVLIPAGFVKVTILEPMSGESLDSFTMDLSELDIQEKFLKTTHSSHSGGLVSTMVKGTDNSNDAIKSALNKIFGSIMQEIDKKLTQKNLESYQKDAKELKGKRNR
Construction	28-260 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	Not tested.
Formulation	Lyophilized from PBS, 6% Trehalose, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 354 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	Neuraminyllactose-binding hemagglutinin, N-acetylneuraminyllactose-binding fibrillar hemagglutinin receptor-binding subunit (NLBH), hpaA, Flagellar sheath adhesin

Chemical Properties

Molecular Weight

33.0 kDa (Predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Related Tags: hpaA Protein, Helicobacter pylori, Recombinant (His) chemical structure | hpaA Protein, Helicobacter pylori, Recombinant (His) molecular weight