Shopping Cart
- Remove All
Your shopping cart is currently empty
Guamerin Protein, Hirudo nipponia, Recombinant (His)
Catalog No. TMPH-00820
Inhibits mammalian elastases. Guamerin Protein, Hirudo nipponia, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 8.1 kDa and the accession number is P46443.
Guamerin Protein, Hirudo nipponia, Recombinant (His)
Catalog No. TMPH-00820
Inhibits mammalian elastases. Guamerin Protein, Hirudo nipponia, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 8.1 kDa and the accession number is P46443.
| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 5 μg | $143 | 20 days | |
| 10 μg | $238 | 20 days | |
| 20 μg | $397 | 20 days | |
| 50 μg | $597 | 20 days | |
| 100 μg | $845 | 20 days | |
| 200 μg | $1,230 | 20 days | |
| 500 μg | $1,980 | 20 days | |
| 1 mg | $2,970 | 20 days |
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Resource Download
Product Information
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Inhibits mammalian elastases. Guamerin Protein, Hirudo nipponia, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 8.1 kDa and the accession number is P46443. |
| Species | Hirudo nipponia |
| Expression System | P. pastoris (Yeast) |
| Tag | N-6xHis |
| Accession Number | P46443 |
| Synonyms | Guamerin |
| Amino Acid | VDENAEDTHGLCGEKTCSPAQVCLNNECACTAIRCMIFCPNGFKVDENGCEYPCTCA |
| Construction | 1-57 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Molecular Weight | 8.1 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
| Research Background | Inhibits mammalian elastases. |
Dose Conversion
You can also refer to dose conversion for different animals. More
Sci Citations
Calculator
Tech Support
Please read the User Guide of Recombinant Proteins for more specific information.
Preview
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.