GLP2R Protein, Human, Recombinant (His)

Name: GLP2R Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-01386
Rating: 4.5 (1 reviews)

(Synonyms: Glucagon-like peptide 2 receptor, GLP-2-R, GLP-2R, GLP2R, GLP-2 receptor) Copy Product Info

Synonyms: Glucagon-like peptide 2 receptor, GLP-2-R, GLP-2R, GLP2R, GLP-2 receptor

Catalog No. TMPH-01386 Copy Product Info

This is a receptor for glucagon-like peptide 2. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. GLP2R Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with C-10xHis tag. The predicted molecular weight is 22.0 kDa and the accession number is O95838.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$50	20 days	20 days
10 µg	$78	20 days	20 days
20 µg	$125	20 days	20 days
50 µg	$222	20 days	20 days
100 µg	$348	20 days	20 days
200 µg	$588	20 days	20 days
500 µg	$1,230	20 days	20 days
1 mg	$2,170	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	This is a receptor for glucagon-like peptide 2. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. GLP2R Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with C-10xHis tag. The predicted molecular weight is 22.0 kDa and the accession number is O95838.
Species	Human
Expression System	HEK293 Cells
Tag	C-10xHis
Accession Number	O95838
Amino Acid	MKLGSSRAGPGRGSAGLLPGVHELPMGIPAPWGTSPLSFHRKCSLWAPGRPFLTLVLLVSIKQVTGSLLEETTRKWAQYKQACLRDLLKEPSGIFCNGTFDQYVCWPHSSPGNVSVPCPSYLPWWSEESSGRAYRHCLAQGTWQTIENATDIWQDDSECSENHSFKQNVDRYA
Construction	1-173 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Glucagon-like peptide 2 receptor, GLP-2-R, GLP-2R, GLP2R, GLP-2 receptor
Research Background	This is a receptor for glucagon-like peptide 2. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.

Chemical Properties

Molecular Weight

22.0 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.