GLP1R Protein, Human, Recombinant (His)

Name: GLP1R Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-01385
Rating: 4.5 (1 reviews)

(Synonyms: Glucagon-like peptide 1 receptor, GLP-1-R, GLP-1R, GLP1R, GLP-1 receptor) Copy Product Info

Synonyms: Glucagon-like peptide 1 receptor, GLP-1-R, GLP-1R, GLP1R, GLP-1 receptor

Catalog No. TMPH-01385 Copy Product Info

G-protein coupled receptor for glucagon-like peptide 1 (GLP-1). Ligand binding triggers activation of a signaling cascade that leads to the activation of adenylyl cyclase and increased intracellular cAMP levels. Plays a role in regulating insulin secretion in response to GLP-1. GLP1R Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with N-6xHis tag. The predicted molecular weight is 18.3 kDa and the accession number is P43220.

Pack Size	Price	USA Stock	Global Stock
5 µg	$50	20 days	20 days
10 µg	$79	20 days	20 days
20 µg	$127	20 days	20 days
50 µg	$225	20 days	20 days
100 µg	$350	20 days	20 days
200 µg	$613	20 days	20 days
500 µg	$1,290	20 days	20 days
1 mg	$2,290	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	G-protein coupled receptor for glucagon-like peptide 1 (GLP-1). Ligand binding triggers activation of a signaling cascade that leads to the activation of adenylyl cyclase and increased intracellular cAMP levels. Plays a role in regulating insulin secretion in response to GLP-1. GLP1R Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with N-6xHis tag. The predicted molecular weight is 18.3 kDa and the accession number is P43220.
Species	Human
Expression System	HEK293 Cells
Tag	N-6xHis
Accession Number	P43220
Amino Acid	RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY
Construction	24-145 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	Glucagon-like peptide 1 receptor, GLP-1-R, GLP-1R, GLP1R, GLP-1 receptor
Research Background	G-protein coupled receptor for glucagon-like peptide 1 (GLP-1). Ligand binding triggers activation of a signaling cascade that leads to the activation of adenylyl cyclase and increased intracellular cAMP levels. Plays a role in regulating insulin secretion in response to GLP-1.

Chemical Properties

Molecular Weight

18.3 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.