Gel4 Protein, Neosartorya fumigata, Recombinant (His)

Name: Gel4 Protein, Neosartorya fumigata, Recombinant (His)
Brand: TargetMol
SKU: TMPH-03050
Rating: 4.5 (1 reviews)

(Synonyms: Glucan elongating glucanosyltransferase 4, gel4, 3-beta-glucanosyltransferase gel4, 1,3-beta-glucanosyltransferase gel4) Copy Product Info

Synonyms: Glucan elongating glucanosyltransferase 4, gel4, 3-beta-glucanosyltransferase gel4, 1,3-beta-glucanosyltransferase gel4

Catalog No. TMPH-03050 Copy Product Info

Splits internally a 1,3-beta-glucan molecule and transfers the newly generated reducing end (the donor) to the non-reducing end of another 1,3-beta-glucan molecule (the acceptor) forming a 1,3-beta linkage, resulting in the elongation of 1,3-beta-glucan chains in the cell wall. Involved in cell wall morphogenesis.

Gel4 Protein, Neosartorya fumigata, Recombinant (His)

Pack Size	Price	USA Stock	Global Stock
5 μg	$143	20 days	20 days
10 μg	$238	20 days	20 days
20 μg	$397	20 days	20 days
50 μg	$597	20 days	20 days
100 μg	$845	20 days	20 days
200 μg	$1,190	20 days	20 days
500 μg	$1,950	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity


Description	Splits internally a 1,3-beta-glucan molecule and transfers the newly generated reducing end (the donor) to the non-reducing end of another 1,3-beta-glucan molecule (the acceptor) forming a 1,3-beta linkage, resulting in the elongation of 1,3-beta-glucan chains in the cell wall. Involved in cell wall morphogenesis.
Species	Neosartorya fumigata
Expression System	P. pastoris (Yeast)
Tag	N-6xHis
Accession Number	P0C956
Amino Acid	KVLKACCWTIALDANSYGNKFFYSNNGTEFFIRGVAYQQEYQANGTSTENSDYTDPLANVDNCKRDIPYLKQLRTNVIRTYAVDPTKDHDECMKLLDDAGIYLITDLSAPSESINRADPAWNTDLYKRYTSVIDAFAKYSNVIGFFAGNEVANDNNNTNSIAYVKAAVRDMKSYIKSKDYRSSLLVGYATDDDAHIRADLADYLVCGDKESSIDMFGYNIYEWCGDSSFEKSGYKDRTEEFSKYPVPAFFSEYGCIDPKPRKFTDVAALYGPQMNDVWSGGIVYMYFQEANDYGLVSVSGDNVKTKEDFSYLSVQMQKVTATGVNSASYTASNTAVPTCPSVGAKWEASNKLPPSPNSELCDCMVETLSCTVKDSVDEKEYGDLFDYLCAAGVCGGINSNSTSGDYGAYSVCSAKQKLSFVMNQYYKKNNKAATACDFDGKAQTKKGADASGSCASLISQAGTAGTGSVTAGATGSSGSGSASETSKGAAGVAA
Construction	26-519 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	Glucan elongating glucanosyltransferase 4, gel4, 3-beta-glucanosyltransferase gel4, 1,3-beta-glucanosyltransferase gel4
Research Background

Chemical Properties

Molecular Weight

55.4 kDa (predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

gel 43-β-glucanosyltransferase gel43-b-glucanosyltransferase gel41,3-β-glucanosyltransferase gel41,3-b-glucanosyltransferase gel4

Related Tags: Gel4 Protein, Neosartorya fumigata, Recombinant (His) chemical structure | Gel4 Protein, Neosartorya fumigata, Recombinant (His) molecular weight