Shopping Cart
Remove All
Your shopping cart is currently empty
FGF-2 Protein, Sheep, Recombinant (His)
(Synonyms: Heparin-binding growth factor 2 (HBGF-2), Fibroblast growth factor 2, FGF-2, FGF2, Basic fibroblast growth factor (bFGF)) Copy Product InfoSynonyms: Heparin-binding growth factor 2 (HBGF-2), Fibroblast growth factor 2, FGF-2, FGF2, Basic fibroblast growth factor (bFGF)
Catalog No. TMPH-04399 Copy Product Info
FGF-2 Protein, Sheep, Recombinant (His) is expressed in E. coli. The accession number is P20003.
Customer service consultation
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $87 | 20 days | 20 days | |
| 10 μg | $139 | 20 days | 20 days | |
| 20 μg | $232 | 20 days | 20 days | |
| 50 μg | $329 | 20 days | 20 days | |
| 100 μg | $435 | 20 days | 20 days | |
| 200 μg | $673 | 20 days | 20 days | |
| 500 μg | $1,180 | 20 days | 20 days | |
| 1 mg | $1,870 | 20 days | 20 days |
For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
Add to Cart
Add to Quotation
For research use only—not for human use. No sales to individuals. Use as intended only.
Resource Download
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | FGF-2 Protein, Sheep, Recombinant (His) is expressed in E. coli. The accession number is P20003. |
| Species | Sheep |
| Expression System | E. coli |
| Tag | C-6xHis |
| Accession Number | P20003 |
| Amino Acid | PALPEDGGSSAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS |
| Construction | 10-155 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Endotoxin | Not tested. |
| Formulation | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 36 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Synonyms | Heparin-binding growth factor 2 (HBGF-2), Fibroblast growth factor 2, FGF-2, FGF2, Basic fibroblast growth factor (bFGF) |
| Molecular Weight | 23.3 kDa (Predicted) |
| Storage | Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months |
Calculator
Dose Conversion
You can also refer to dose conversion for different animals. More Dose Conversion
Tech Support
Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc
Preview
Related Tags: FGF-2 Protein, Sheep, Recombinant (His) chemical structure | FGF-2 Protein, Sheep, Recombinant (His) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.