FGF-2 Protein, Sheep, Recombinant (His)

Name: FGF-2 Protein, Sheep, Recombinant (His)
Brand: TargetMol
SKU: TMPH-04399
Rating: 4.5 (1 reviews)

(Synonyms: Heparin-binding growth factor 2 (HBGF-2), Fibroblast growth factor 2, FGF-2, FGF2, Basic fibroblast growth factor (bFGF)) Copy Product Info

Synonyms: Heparin-binding growth factor 2 (HBGF-2), Fibroblast growth factor 2, FGF-2, FGF2, Basic fibroblast growth factor (bFGF)

Catalog No. TMPH-04399 Copy Product Info

FGF-2 Protein, Sheep, Recombinant (His) is expressed in E. coli. The accession number is P20003.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$87	20 days	20 days
10 µg	$139	20 days	20 days
20 µg	$232	20 days	20 days
50 µg	$329	20 days	20 days
100 µg	$435	20 days	20 days
200 µg	$673	20 days	20 days
500 µg	$1,180	20 days	20 days
1 mg	$1,870	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	FGF-2 Protein, Sheep, Recombinant (His) is expressed in E. coli. The accession number is P20003.
Species	Sheep
Expression System	E. coli
Tag	C-6xHis
Accession Number	P20003
Amino Acid	PALPEDGGSSAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS
Construction	10-155 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	Not tested.
Formulation	Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Heparin-binding growth factor 2 (HBGF-2), Fibroblast growth factor 2, FGF-2, FGF2, Basic fibroblast growth factor (bFGF)

Chemical Properties

Molecular Weight

23.3 kDa (Predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 36 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.