Shopping Cart
- Remove All
- Your shopping cart is currently empty
FadL Protein, Shigella flexneri, Recombinant (His) is expressed in E. coli. The accession number is P59741.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
20 μg | $393 | 20 days | |
100 μg | $756 | 20 days | |
1 mg | $2,550 | 20 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | FadL Protein, Shigella flexneri, Recombinant (His) is expressed in E. coli. The accession number is P59741. |
Species | Shigella flexneri |
Expression System | E. coli |
Tag | C-6xHis |
Accession Number | P59741 |
Synonyms | Outer membrane flp protein,Outer membrane FadL protein,Long-chain fatty acid transport protein,fadL |
Amino Acid | AGFQLNEFSSSGLGRAYSGEGAIADDAGNVSRNPALITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWGASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAIYARAKIERFAGDLGQLVAGQIMQSPAGQTPQGQALAATANGIDSNTKIAHLNGNQWGFGWNAGILYELDKNNRYALTYRSEVKIDFKGNYSSDLNRAFNNYGLPIPTATGGATQSGYLTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWSQFQQLKATSTSGDTLFQKHEGFKDAYRIALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAF |
Construction | 26-446 aa |
Protein Purity | > 85% as determined by SDS-PAGE. |
Molecular Weight | 52.8 kDa (Predicted) |
Endotoxin | Not tested. |
Formulation | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 35 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.