Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

EsxA Protein, S. aureus, Recombinant (His & SUMO)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03550 Copy Product Info
Virulence factor that is important for the establishment of infection in the host. EsxA is required for EsxB synthesis as well as secretion. Modulates host cell apoptotic pathways and mediates together with EsxB the release of S.aureus from the host cell. By acting on apoptosis, plays a role in the modulation of dendritic cell-mediated immunity. EsxA Protein, S. aureus, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 27.0 kDa and the accession number is Q6GCJ0.

EsxA Protein, S. aureus, Recombinant (His & SUMO)

Catalog No. TMPH-03550
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

Virulence factor that is important for the establishment of infection in the host. EsxA is required for EsxB synthesis as well as secretion. Modulates host cell apoptotic pathways and mediates together with EsxB the release of S.aureus from the host cell. By acting on apoptosis, plays a role in the modulation of dendritic cell-mediated immunity. EsxA Protein, S. aureus, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 27.0 kDa and the accession number is Q6GCJ0.

EsxA Protein, S. aureus, Recombinant (His & SUMO)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$12920 days20 days
10 μg$21620 days20 days
20 μg$36020 days20 days
50 μg$54320 days20 days
100 μg$74520 days20 days
200 μg$1,07020 days20 days
500 μg$1,73020 days20 days
1 mg$2,53020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Virulence factor that is important for the establishment of infection in the host. EsxA is required for EsxB synthesis as well as secretion. Modulates host cell apoptotic pathways and mediates together with EsxB the release of S.aureus from the host cell. By acting on apoptosis, plays a role in the modulation of dendritic cell-mediated immunity. EsxA Protein, S. aureus, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 27.0 kDa and the accession number is Q6GCJ0.
Species
Staphylococcus aureus
Expression System
E. coli
TagN-6xHis-SUMO
Accession NumberQ6GCJ0
Synonyms
Type VII secretion system extracellular protein A,esxA,Ess extracellular protein A
Amino Acid
MAMIKMSPEEIRAKSQSYGQGSDQIRQILSDLTRAQGEIAANWEGQAFSRFEEQFQQLSPKVEKFAQLLEEIKQQLNSTADAVQEQDQQLSNNFGLQ
Construction
1-97 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight27.0 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Virulence factor that is important for the establishment of infection in the host. EsxA is required for EsxB synthesis as well as secretion. Modulates host cell apoptotic pathways and mediates together with EsxB the release of S.aureus from the host cell. By acting on apoptosis, plays a role in the modulation of dendritic cell-mediated immunity.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.