Shopping Cart
Remove All
Your shopping cart is currently empty
Enteropeptidase Protein, Mouse, Recombinant (His & SUMO)
(Synonyms: Transmembrane protease serine 15, Tmprss15, Serine protease 7, Prss7, Entk, Enteropeptidase, Enterokinase) Copy Product InfoSynonyms: Transmembrane protease serine 15, Tmprss15, Serine protease 7, Prss7, Entk, Enteropeptidase, Enterokinase
Catalog No. TMPH-02644 Copy Product Info
Responsible for initiating activation of pancreatic proteolytic proenzymes (trypsin, chymotrypsin and carboxypeptidase A). It catalyzes the conversion of trypsinogen to trypsin which in turn activates other proenzymes including chymotrypsinogen, procarboxypeptidases, and proelastases. Enteropeptidase Protein, Mouse, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 43.0 kDa and the accession number is P97435.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $105 | 20 days | 20 days | |
| 10 μg | $169 | 20 days | 20 days | |
| 20 μg | $283 | 20 days | 20 days | |
| 50 μg | $428 | 20 days | 20 days | |
| 100 μg | $590 | 20 days | 20 days | |
| 200 μg | $913 | 20 days | 20 days | |
| 500 μg | $1,620 | 20 days | 20 days | |
| 1 mg | $2,530 | 20 days | 20 days |
For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
Add to Cart
Add to Quotation
For research use only—not for human use. No sales to individuals. Use as intended only.
Resource Download
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Description | Responsible for initiating activation of pancreatic proteolytic proenzymes (trypsin, chymotrypsin and carboxypeptidase A). It catalyzes the conversion of trypsinogen to trypsin which in turn activates other proenzymes including chymotrypsinogen, procarboxypeptidases, and proelastases. Enteropeptidase Protein, Mouse, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 43.0 kDa and the accession number is P97435. |
| Species | Mouse |
| Expression System | E. coli |
| Tag | N-6xHis-SUMO |
| Accession Number | P97435 |
| Amino Acid | IVGGSDAQAGAWPWVVALYHRDRSTDRLLCGASLVSSDWLVSAAHCVYRRNLDPTRWTAVLGLHMQSNLTSPQVVRRVVDQIVINPHYDRRRKVNDIAMMHLEFKVNYTDYIQPICLPEENQIFIPGRTCSIAGWGYDKINAGSTVDVLKEADVPLISNEKCQQQLPEYNITESMICAGYEEGGIDSCQGDSGGPLMCQENNRWFLVGVTSFGVQCALPNHPGVYVRVSQFIEWIHSFLH |
| Construction | 830-1069 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Synonyms | Transmembrane protease serine 15, Tmprss15, Serine protease 7, Prss7, Entk, Enteropeptidase, Enterokinase |
| Research Background |
| Molecular Weight | 43.0 kDa (predicted) |
| Storage | Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months |
Calculator
Dose Conversion
You can also refer to dose conversion for different animals. More Dose Conversion
Tech Support
Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc
Keywords
Preview
Related Tags: Enteropeptidase Protein, Mouse, Recombinant (His & SUMO) chemical structure | Enteropeptidase Protein, Mouse, Recombinant (His & SUMO) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.