Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

EIF3E Protein, Human, Recombinant (His)

Catalog No. TMPH-03916

EIF3E Protein, Human, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is P60228.

EIF3E Protein, Human, Recombinant (His)

EIF3E Protein, Human, Recombinant (His)

Catalog No. TMPH-03916
EIF3E Protein, Human, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is P60228.
Pack SizePriceAvailabilityQuantity
20 μg $28320 days
100 μg $53720 days
1 mg $2,30020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description
EIF3E Protein, Human, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is P60228.
Species
Human
Expression System
E. coli
TagC-6xHis
Accession NumberP60228
Synonyms
Viral integration site protein INT-6 homolog,INT6,Eukaryotic translation initiation factor 3 subunit E,Eukaryotic translation initiation factor 3 subunit 6,EIF3S6,EIF3E,eIF3e,eIF-3 p48
Amino Acid
MAEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADKHGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQNWDAAMEDLTRLKETIDNNSVSSPLQSLQQRTWLIHWSLFVFFNHPKGRDNIIDLFLYQPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECLYVNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY
Construction
1-445 aa
Protein Purity
>85% as determined by SDS-PAGE.
Molecular Weight59.2 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords