Shopping Cart
- Remove All
- Your shopping cart is currently empty
Dihydroneopterin aldolase Protein, E. coli, Recombinant (His & Myc) is expressed in E. coli. The accession number is P0AC16.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
20 μg | $266 | 20 days | |
100 μg | $498 | 20 days | |
1 mg | $2,130 | 20 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | Dihydroneopterin aldolase Protein, E. coli, Recombinant (His & Myc) is expressed in E. coli. The accession number is P0AC16. |
Species | E. coli (strain K12) |
Expression System | E. coli |
Tag | N-10xHis, C-Myc |
Accession Number | P0AC16 |
Synonyms | ygiG,folB,Dihydroneopterin epimerase,Dihydroneopterin aldolase,DHNA,7,8-dihydroneopterin epimerase,7,8-dihydroneopterin aldolase,7,8-dihydroneopterin 2'-epimerase |
Amino Acid | MDIVFIEQLSVITTIGVYDWEQTIEQKLVFDIEMAWDNRKAAKSDDVADCLSYADIAETVVSHVEGARFALVERVAEEVAELLLARFNSPWVRIKLSKPGAVARAANVGVIIERGNNLKENN |
Construction | 1-122 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 18.6 kDa (Predicted) |
Endotoxin | Not tested. |
Formulation | Lyophilized from PBS, 6% Trehalose, pH 7.4 |
Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 370 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.