Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Dermcidin Protein, Human, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-04803 Copy Product Info
Dermcidin Protein, Human, Recombinant (His) is expressed in P. pastoris (Yeast). The accession number is P81605.

Dermcidin Protein, Human, Recombinant (His)

Catalog No. TMPH-04803
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

Dermcidin Protein, Human, Recombinant (His) is expressed in P. pastoris (Yeast). The accession number is P81605.

Dermcidin Protein, Human, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$86-In Stock
10 μg$139-In Stock
20 μg$222-In Stock
50 μg$29320 days20 days
100 μg$41820 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Select Batch

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description
Dermcidin Protein, Human, Recombinant (His) is expressed in P. pastoris (Yeast). The accession number is P81605.
Species
Human
Expression System
P. pastoris (Yeast)
TagN-6xHis
Accession NumberP81605
Synonyms
Preproteolysin,DSEP,Dermcidin,DCD,AIDD
Amino Acid
YDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL
Construction
20-110 aa
Protein Purity
> 90% as determined by SDS-PAGE
Dermcidin Protein, Human, Recombinant (His)
Molecular Weight11.3 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
DCD-1 displays antimicrobial activity thereby limiting skin infection by potential pathogens in the first few hours after bacterial colonization. Highly effective against E.coli, E.faecalis, S.aureus and C.albicans. Optimal pH and salt concentration resemble the conditions in sweat. Also exhibits proteolytic activity, cleaving on the C-terminal side of Arg and, to a lesser extent, Lys residues

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.