Dermcidin Protein, Human, Recombinant (His)

Name: Dermcidin Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-04803
Price: 86 USD
Availability: InStock
Rating: 5 (10 reviews)

(Synonyms: Preproteolysin, DSEP, Dermcidin, DCD, AIDD) Copy Product Info

Synonyms: Preproteolysin, DSEP, Dermcidin, DCD, AIDD

Catalog No. TMPH-04803 Copy Product Info

Purity: 98%

Dermcidin Protein, Human, Recombinant (His) is expressed in P. pastoris (Yeast). The accession number is P81605.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$86	-	In Stock
10 µg	$139	-	In Stock
20 µg	$222	-	In Stock
50 µg	$293	20 days	20 days
100 µg	$418	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:98%

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description	Dermcidin Protein, Human, Recombinant (His) is expressed in P. pastoris (Yeast). The accession number is P81605.
Species	Human
Expression System	P. pastoris (Yeast)
Tag	N-6xHis
Accession Number	P81605
Amino Acid	YDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL
Construction	20-110 aa
Protein Purity	> 90% as determined by SDS-PAGE
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Preproteolysin, DSEP, Dermcidin, DCD, AIDD
Research Background	DCD-1 displays antimicrobial activity thereby limiting skin infection by potential pathogens in the first few hours after bacterial colonization. Highly effective against E.coli, E.faecalis, S.aureus and C.albicans. Optimal pH and salt concentration resemble the conditions in sweat. Also exhibits proteolytic activity, cleaving on the C-terminal side of Arg and, to a lesser extent, Lys residues

Chemical Properties

Molecular Weight

11.3 kDa (Predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.