Shopping Cart
Remove All
Your shopping cart is currently empty
DEFB1 Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P60022.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $130 | 20 days | 20 days | |
| 10 μg | $198 | 20 days | 20 days | |
| 20 μg | $338 | 20 days | 20 days | |
| 50 μg | $655 | 20 days | 20 days | |
| 100 μg | $1,080 | 20 days | 20 days | |
| 200 μg | $1,530 | 20 days | 20 days | |
| 500 μg | $2,430 | 20 days | 20 days |
| Biological Activity | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using CD34+ dendritic cells is in a concentration range of 100.0-1000.0 ng/ml. |
| Description | DEFB1 Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P60022. |
| Species | Human |
| Expression System | E. coli |
| Tag | Tag Free |
| Accession Number | P60022 |
| Synonyms | hBD-1,HBD1,Defensin, beta 1,DEFB1,Beta-defensin 1,BD-1,BD1 |
| Amino Acid | GNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
| Construction | 22-68 aa |
| Protein Purity | >98% as determined by SDS-PAGE. |
| Molecular Weight | 5.1 kDa (Predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a 0.2 µm filtered 20 mM PB, pH 7.4, 130 mM NaCl |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.