Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

DEFB1 Protein, Human, Recombinant (Active)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03812 Copy Product Info
DEFB1 Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P60022.

DEFB1 Protein, Human, Recombinant (Active)

Catalog No. TMPH-03812
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

DEFB1 Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P60022.

DEFB1 Protein, Human, Recombinant (Active)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$13020 days20 days
10 μg$19820 days20 days
20 μg$33820 days20 days
50 μg$65520 days20 days
100 μg$1,08020 days20 days
200 μg$1,53020 days20 days
500 μg$2,43020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using CD34+ dendritic cells is in a concentration range of 100.0-1000.0 ng/ml.
Description
DEFB1 Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P60022.
Species
Human
Expression System
E. coli
TagTag Free
Accession NumberP60022
Synonyms
hBD-1,HBD1,Defensin, beta 1,DEFB1,Beta-defensin 1,BD-1,BD1
Amino Acid
GNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
Construction
22-68 aa
Protein Purity
>98% as determined by SDS-PAGE.
Molecular Weight5.1 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 µm filtered 20 mM PB, pH 7.4, 130 mM NaCl
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords