DEFB1 Protein, Human, Recombinant (Active)

Catalog No. TMPH-03812

DEFB1 Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P60022.

DEFB1 Protein, Human, Recombinant (Active)

Catalog No. TMPH-03812

DEFB1 Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P60022.

Pack Size	Price	Availability
5 μg	$130	20 days
10 μg	$198	20 days
20 μg	$338	20 days
50 μg	$655	20 days
100 μg	$1,080	20 days
200 μg	$1,530	20 days
500 μg	$2,430	20 days

Bulk & Custom

Add to Cart

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using CD34+ dendritic cells is in a concentration range of 100.0-1000.0 ng/ml.
Description	DEFB1 Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P60022.
Species	Human
Expression System	E. coli
Tag	Tag Free
Accession Number	P60022
Synonyms	hBD-1,HBD1,Defensin, beta 1,DEFB1,Beta-defensin 1,BD-1,BD1
Amino Acid	GNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
Construction	22-68 aa
Protein Purity	>98% as determined by SDS-PAGE.
Molecular Weight	5.1 kDa (Predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a 0.2 µm filtered 20 mM PB, pH 7.4, 130 mM NaCl
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.