Home Tools
Log in
Cart

DEFB19 Protein, Mouse, Recombinant (His & Myc)

Catalog No. TMPH-02542
Synonyms: Defensin, beta 19, Tdl, Testis-specific beta-defensin-like protein, Defb19, mBD-19, Beta-defensin 19, BD-19, Defb24

Has antibacterial activity.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
DEFB19 Protein, Mouse, Recombinant (His & Myc)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 360.00
100 μg 20 days $ 678.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Has antibacterial activity.
Species Mouse
Expression System E. coli
Tag N-terminal 10xHis-tagged and C-terminal Myc-tagged
Accession Number Q8K3I8
Synonyms Defensin, beta 19, Tdl, Testis-specific beta-defensin-like protein, Defb19, mBD-19, Beta-defensin 19, BD-19, Defb24
Amino Acid GKNPILQCMGNRGFCRSSCKKSEQAYFYCRTFQMCCLQSYVRISLTGVDDNTNWSYEKHWPRIP Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Construction 20-83 aa
Protein Purity > 85% as determined by SDS-PAGE.
Molecular Weight 15.0 kDa as predicted
Formulation If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage

Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shipping

In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise.

Research Background Has antibacterial activity.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

DEFB19 Protein, Mouse, Recombinant (His & Myc) Defensin, beta 19 Tdl Testis-specific beta-defensin-like protein Defb19 mBD-19 Beta-defensin 19 BD-19 Defb24 recombinant recombinant-proteins proteins protein

 

TargetMol