Cytidylate kinase Protein, E. coli, Recombinant (His & SUMO)

Name: Cytidylate kinase Protein, E. coli, Recombinant (His & SUMO)
Brand: TargetMol
SKU: TMPH-00603
Rating: 4.5 (1 reviews)

(Synonyms: ycaG, ycaF, Protein MssA, p25, mssA, Cytidylate kinase, Cytidine monophosphate kinase (CMP kinase), cmk, CK) Copy Product Info

Synonyms: ycaG, ycaF, Protein MssA, p25, mssA, Cytidylate kinase, Cytidine monophosphate kinase (CMP kinase), cmk, CK

Catalog No. TMPH-00603 Copy Product Info

ATP, dATP, and GTP are equally effective as phosphate donors. CMP and dCMP are the best phosphate acceptors.

Cytidylate kinase Protein, E. coli, Recombinant (His & SUMO)

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 μg	$129	20 days	20 days
10 μg	$216	20 days	20 days
20 μg	$360	20 days	20 days
50 μg	$543	20 days	20 days
100 μg	$745	20 days	20 days
200 μg	$1,070	20 days	20 days
500 μg	$1,730	20 days	20 days
1 mg	$2,530	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity


Description	ATP, dATP, and GTP are equally effective as phosphate donors. CMP and dCMP are the best phosphate acceptors.
Species	E. coli
Expression System	E. coli
Tag	N-6xHis-SUMO
Accession Number	P0A6I0
Amino Acid	MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHHVDVASEDALVPLASHLDVRFVSTNGNLEVILEGEDVSGEIRTQEVANAASQVAAFPRVREALLRRQRAFRELPGLIADGRDMGTVVFPDAPVKIFLDASSEERAHRRMLQLQEKGFSVNFERLLAEIKERDDRDRNRAVAPLVPAADALVLDSTTLSIEQVIEKALQYARQKLALA
Construction	1-227 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	ycaG, ycaF, Protein MssA, p25, mssA, Cytidylate kinase, Cytidine monophosphate kinase (CMP kinase), cmk, CK
Research Background

Chemical Properties

Molecular Weight

40.7 kDa (predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

p 25CMP kinase

Related Tags: Cytidylate kinase Protein, E. coli, Recombinant (His & SUMO) chemical structure | Cytidylate kinase Protein, E. coli, Recombinant (His & SUMO) molecular weight