Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

CT83 Protein-VLP, Human, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-01594 Copy Product Info
CT83 Protein-VLP, Human, Recombinant (His) is expressed in HEK293.

CT83 Protein-VLP, Human, Recombinant (His)

Catalog No. TMPH-01594
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

CT83 Protein-VLP, Human, Recombinant (His) is expressed in HEK293.

CT83 Protein-VLP, Human, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$28920 days20 days
10 μg$48320 days20 days
20 μg$81520 days20 days
50 μg$1,33020 days20 days
100 μg$1,96020 days20 days
200 μg$3,27020 days20 days
500 μg$6,45020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
CT83 Protein-VLP, Human, Recombinant (His) is expressed in HEK293.
Species
Human
Expression System
HEK293 Cells
TagN-6xHis(This tag can be tested only under denaturing conditions)
Accession NumberQ5H943
Synonyms
KK-LC-1,KKLC1,Kita-kyushu lung cancer antigen 1,CXorf61,CT83,Cancer/testis antigen 83
Amino Acid
MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST
Construction
1-113 aa
Molecular Weight14.0 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationPBS, pH 7.4, 6% trehalose
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
N/A

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords