CT83 Protein-VLP, Human, Recombinant (His) is expressed in HEK293.
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
20 μg | 20 days | $ 397.00 | |
100 μg | 20 days | $ 1,140.00 |
Description | CT83 Protein-VLP, Human, Recombinant (His) is expressed in HEK293. |
Species | Human |
Expression System | HEK293 |
Tag | N-terminal 6xHis-tagged(This tag can be tested only under denaturing conditions) |
Accession Number | Q5H943 |
Synonyms | CXorf61, KK-LC-1, Cancer/testis antigen 83, Kita-kyushu lung cancer antigen 1, KKLC1, CT83 |
Amino Acid | MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST |
Construction | 1-113 aa |
Molecular Weight | 14.0 kDa as predicted |
Endotoxin | < 1.0 EU per μg protein as determined by the LAL method. |
Formulation | PBS, pH 7.4, 6% trehalose |
Reconstitution | A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information. |
Stability & Storage |
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Shipping |
In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise. |
Research Background | N/A |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
CT83 Protein-VLP, Human, Recombinant (His) CXorf61 KK-LC-1 Cancer/testis antigen 83 Kita-kyushu lung cancer antigen 1 KKLC1 CT83 recombinant recombinant-proteins proteins protein