Shopping Cart
Remove All
Your shopping cart is currently empty
Synonyms: KK-LC-1, KKLC1, Kita-kyushu lung cancer antigen 1, CXorf61, CT83, Cancer/testis antigen 83


| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $289 | 20 days | 20 days | |
| 10 μg | $483 | 20 days | 20 days | |
| 20 μg | $815 | 20 days | 20 days | |
| 50 μg | $1,330 | 20 days | 20 days | |
| 100 μg | $1,960 | 20 days | 20 days | |
| 200 μg | $3,270 | 20 days | 20 days | |
| 500 μg | $6,450 | 20 days | 20 days |
| Description | CT83 Protein-VLP, Human, Recombinant (His) is expressed in HEK293. |
| Species | Human |
| Expression System | HEK293 Cells |
| Tag | N-6xHis(This tag can be tested only under denaturing conditions) |
| Accession Number | Q5H943 |
| Amino Acid | MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST |
| Construction | 1-113 aa |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | PBS, pH 7.4, 6% trehalose |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Synonyms | KK-LC-1, KKLC1, Kita-kyushu lung cancer antigen 1, CXorf61, CT83, Cancer/testis antigen 83 |
| Research Background |
| Molecular Weight | 14.0 kDa (predicted) |
| Storage | Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.