CT83 Protein-VLP, Human, Recombinant (His)

Name: CT83 Protein-VLP, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-01594
Rating: 4.5 (1 reviews)

(Synonyms: KK-LC-1, KKLC1, Kita-kyushu lung cancer antigen 1, CXorf61, CT83, Cancer/testis antigen 83) Copy Product Info

Synonyms: KK-LC-1, KKLC1, Kita-kyushu lung cancer antigen 1, CXorf61, CT83, Cancer/testis antigen 83

Catalog No. TMPH-01594 Copy Product Info

CT83 Protein-VLP, Human, Recombinant (His) is expressed in HEK293.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$289	20 days	20 days
10 µg	$483	20 days	20 days
20 µg	$815	20 days	20 days
50 µg	$1,330	20 days	20 days
100 µg	$1,960	20 days	20 days
200 µg	$3,270	20 days	20 days
500 µg	$6,450	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	CT83 Protein-VLP, Human, Recombinant (His) is expressed in HEK293.
Species	Human
Expression System	HEK293 Cells
Tag	N-6xHis(This tag can be tested only under denaturing conditions)
Accession Number	Q5H943
Amino Acid	MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST
Construction	1-113 aa
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	PBS, pH 7.4, 6% trehalose
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	KK-LC-1, KKLC1, Kita-kyushu lung cancer antigen 1, CXorf61, CT83, Cancer/testis antigen 83
Research Background	N/A

Chemical Properties

Molecular Weight

14.0 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.