Home Tools
Log in
Cart

CT83 Protein-VLP, Human, Recombinant (His)

Catalog No. TMPH-01594
Synonyms: CXorf61, KK-LC-1, Cancer/testis antigen 83, Kita-kyushu lung cancer antigen 1, KKLC1, CT83

CT83 Protein-VLP, Human, Recombinant (His) is expressed in HEK293.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
CT83 Protein-VLP, Human, Recombinant (His)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 397.00
100 μg 20 days $ 1,140.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description CT83 Protein-VLP, Human, Recombinant (His) is expressed in HEK293.
Species Human
Expression System HEK293
Tag N-terminal 6xHis-tagged(This tag can be tested only under denaturing conditions)
Accession Number Q5H943
Synonyms CXorf61, KK-LC-1, Cancer/testis antigen 83, Kita-kyushu lung cancer antigen 1, KKLC1, CT83
Amino Acid MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST
Construction 1-113 aa
Molecular Weight 14.0 kDa as predicted
Endotoxin < 1.0 EU per μg protein as determined by the LAL method.
Formulation PBS, pH 7.4, 6% trehalose
Reconstitution A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage

Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shipping

In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise.

Research Background N/A

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

CT83 Protein-VLP, Human, Recombinant (His) CXorf61 KK-LC-1 Cancer/testis antigen 83 Kita-kyushu lung cancer antigen 1 KKLC1 CT83 recombinant recombinant-proteins proteins protein

 

TargetMol