Promotes colloidosmotic lysis by binding to the midgut epithelial cells of both dipteran (Aedes aegypti) and lepidopteran (Manduca sexta) larvae. Cry2Aa Protein, Bacillus thuringiensis subsp., Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 29.7 kDa and the accession number is P0A377.
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
20 μg | 20 days | $ 360.00 | |
100 μg | 20 days | $ 678.00 | |
1 mg | 20 days | $ 2,300.00 |
Description | Promotes colloidosmotic lysis by binding to the midgut epithelial cells of both dipteran (Aedes aegypti) and lepidopteran (Manduca sexta) larvae. Cry2Aa Protein, Bacillus thuringiensis subsp., Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 29.7 kDa and the accession number is P0A377. |
Species | Bacillus thuringiensis subsp. kurstaki |
Expression System | E. coli |
Tag | N-10xHis, C-Myc |
Accession Number | P0A377 |
Synonyms | cryB1, P2 crystal protein, Crystaline entomocidal protoxin, cryIIA(a), Mosquito factor, cryII, cry2Aa, Insecticidal delta-endotoxin CryIIA(a), 71 kDa crystal protein, Pesticidal crystal protein Cry2Aa |
Amino Acid | LMVSSGANLYASGSGPQQTQSFTAQNWPFLYSLFQVNSNYILSGISGTRLSITFPNIGGLPGSTTTHSLNSARVNYSGGVSSGLIGATNLNHNFNCSTVLPPLSTPFVRSWLDSGTDREGVATSTNWQTESFQTTLSLRCGAFSARGNSNYFPDYFIRNISGVPLVIRNEDLTRPLHYNQIRNIESPSGTPGGARAYLVSVHNRKN |
Construction | 267-472 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 29.7 kDa (predicted) |
Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage |
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping |
In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Promotes colloidosmotic lysis by binding to the midgut epithelial cells of both dipteran (Aedes aegypti) and lepidopteran (Manduca sexta) larvae. |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
Cry2Aa Protein, Bacillus thuringiensis subsp., Recombinant (His & Myc) cryB1 P2 crystal protein Crystaline entomocidal protoxin cryIIA(a) Mosquito factor cryII cry2Aa Insecticidal delta-endotoxin CryIIA(a) 71 kDa crystal protein Pesticidal crystal protein Cry2Aa recombinant recombinant-proteins proteins protein