Home Tools
Log in
Cart

Cry2Aa Protein, Bacillus thuringiensis subsp., Recombinant (His & Myc)

Catalog No. TMPH-00182
Synonyms: cryB1, P2 crystal protein, Crystaline entomocidal protoxin, cryIIA(a), Mosquito factor, cryII, cry2Aa, Insecticidal delta-endotoxin CryIIA(a), 71 kDa crystal protein, Pesticidal crystal protein Cry2Aa

Promotes colloidosmotic lysis by binding to the midgut epithelial cells of both dipteran (Aedes aegypti) and lepidopteran (Manduca sexta) larvae. Cry2Aa Protein, Bacillus thuringiensis subsp., Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 29.7 kDa and the accession number is P0A377.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
Cry2Aa Protein, Bacillus thuringiensis subsp., Recombinant (His & Myc)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 360.00
100 μg 20 days $ 678.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Promotes colloidosmotic lysis by binding to the midgut epithelial cells of both dipteran (Aedes aegypti) and lepidopteran (Manduca sexta) larvae. Cry2Aa Protein, Bacillus thuringiensis subsp., Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 29.7 kDa and the accession number is P0A377.
Species Bacillus thuringiensis subsp. kurstaki
Expression System E. coli
Tag N-10xHis, C-Myc
Accession Number P0A377
Synonyms cryB1, P2 crystal protein, Crystaline entomocidal protoxin, cryIIA(a), Mosquito factor, cryII, cry2Aa, Insecticidal delta-endotoxin CryIIA(a), 71 kDa crystal protein, Pesticidal crystal protein Cry2Aa
Amino Acid LMVSSGANLYASGSGPQQTQSFTAQNWPFLYSLFQVNSNYILSGISGTRLSITFPNIGGLPGSTTTHSLNSARVNYSGGVSSGLIGATNLNHNFNCSTVLPPLSTPFVRSWLDSGTDREGVATSTNWQTESFQTTLSLRCGAFSARGNSNYFPDYFIRNISGVPLVIRNEDLTRPLHYNQIRNIESPSGTPGGARAYLVSVHNRKN
Construction 267-472 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 29.7 kDa (predicted)
Formulation If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Research Background Promotes colloidosmotic lysis by binding to the midgut epithelial cells of both dipteran (Aedes aegypti) and lepidopteran (Manduca sexta) larvae.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

Cry2Aa Protein, Bacillus thuringiensis subsp., Recombinant (His & Myc) cryB1 P2 crystal protein Crystaline entomocidal protoxin cryIIA(a) Mosquito factor cryII cry2Aa Insecticidal delta-endotoxin CryIIA(a) 71 kDa crystal protein Pesticidal crystal protein Cry2Aa recombinant recombinant-proteins proteins protein

 

TargetMol