Promotes colloidosmotic lysis by binding to the midgut epithelial cells of certain coleopteran and lepidopteran species. Active on Plutella xylostella and Bombyx mori. Cry1Ia Protein, Bacillus thuringiensis subsp., Recombinant (His & KSI) is expressed in E. coli expression system with N-6xHis-KSI tag. The predicted molecular weight is 24.9 kDa and the accession number is Q45752.
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
20 μg | 20 days | $ 360.00 | |
100 μg | 20 days | $ 678.00 | |
1 mg | 20 days | $ 2,300.00 |
Description | Promotes colloidosmotic lysis by binding to the midgut epithelial cells of certain coleopteran and lepidopteran species. Active on Plutella xylostella and Bombyx mori. Cry1Ia Protein, Bacillus thuringiensis subsp., Recombinant (His & KSI) is expressed in E. coli expression system with N-6xHis-KSI tag. The predicted molecular weight is 24.9 kDa and the accession number is Q45752. |
Species | Bacillus thuringiensis subsp. Kurstaki |
Expression System | E. coli |
Tag | N-6xHis-KSI |
Accession Number | Q45752 |
Synonyms | cryV1, cry1Ia, cryV, 81 kDa crystal protein, Insecticidal delta-endotoxin CryII(a), Crystaline entomocidal protoxin, Pesticidal crystal protein Cry1Ia, cryII(a), CGCryV |
Amino Acid | GKNQWEIFMEHVEEIINQKISTYARNKALTDLKGLGDALAVYHDSLESWVGNRNNTRARSVVKSQYIALELMFVQKLPSFAVSG |
Construction | 97-180 aa |
Protein Purity | > 85% as determined by SDS-PAGE. |
Molecular Weight | 24.9 kDa (predicted) |
Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage |
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted protein solutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping |
In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Promotes colloidosmotic lysis by binding to the midgut epithelial cells of certain coleopteran and lepidopteran species. Active on Plutella xylostella and Bombyx mori. |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
Cry1Ia Protein, Bacillus thuringiensis subsp., Recombinant (His & KSI) cryV1 cry1Ia cryV 81 kDa crystal protein Insecticidal delta-endotoxin CryII(a) Crystaline entomocidal protoxin Pesticidal crystal protein Cry1Ia cryII(a) CGCryV recombinant recombinant-proteins proteins protein