Home Tools
Log in
Cart

Cry1Ia Protein, Bacillus thuringiensis subsp., Recombinant (His & KSI)

Catalog No. TMPH-00181
Synonyms: cryV1, cry1Ia, cryV, 81 kDa crystal protein, Insecticidal delta-endotoxin CryII(a), Crystaline entomocidal protoxin, Pesticidal crystal protein Cry1Ia, cryII(a), CGCryV

Promotes colloidosmotic lysis by binding to the midgut epithelial cells of certain coleopteran and lepidopteran species. Active on Plutella xylostella and Bombyx mori. Cry1Ia Protein, Bacillus thuringiensis subsp., Recombinant (His & KSI) is expressed in E. coli expression system with N-6xHis-KSI tag. The predicted molecular weight is 24.9 kDa and the accession number is Q45752.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
Cry1Ia Protein, Bacillus thuringiensis subsp., Recombinant (His & KSI)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 360.00
100 μg 20 days $ 678.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Promotes colloidosmotic lysis by binding to the midgut epithelial cells of certain coleopteran and lepidopteran species. Active on Plutella xylostella and Bombyx mori. Cry1Ia Protein, Bacillus thuringiensis subsp., Recombinant (His & KSI) is expressed in E. coli expression system with N-6xHis-KSI tag. The predicted molecular weight is 24.9 kDa and the accession number is Q45752.
Species Bacillus thuringiensis subsp. Kurstaki
Expression System E. coli
Tag N-6xHis-KSI
Accession Number Q45752
Synonyms cryV1, cry1Ia, cryV, 81 kDa crystal protein, Insecticidal delta-endotoxin CryII(a), Crystaline entomocidal protoxin, Pesticidal crystal protein Cry1Ia, cryII(a), CGCryV
Amino Acid GKNQWEIFMEHVEEIINQKISTYARNKALTDLKGLGDALAVYHDSLESWVGNRNNTRARSVVKSQYIALELMFVQKLPSFAVSG
Construction 97-180 aa
Protein Purity > 85% as determined by SDS-PAGE.
Molecular Weight 24.9 kDa (predicted)
Formulation If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted protein solutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Research Background Promotes colloidosmotic lysis by binding to the midgut epithelial cells of certain coleopteran and lepidopteran species. Active on Plutella xylostella and Bombyx mori.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

Cry1Ia Protein, Bacillus thuringiensis subsp., Recombinant (His & KSI) cryV1 cry1Ia cryV 81 kDa crystal protein Insecticidal delta-endotoxin CryII(a) Crystaline entomocidal protoxin Pesticidal crystal protein Cry1Ia cryII(a) CGCryV recombinant recombinant-proteins proteins protein

 

TargetMol