Home Tools
Log in
Cart

Cry1Fb Protein, Bacillus thuringiensis subsp., Recombinant (His)

Catalog No. TMPH-00184
Synonyms: cryIF(b), Crystaline entomocidal protoxin, Insecticidal delta-endotoxin CryIF(b), cryINA67-1, cry1Fb, 132 kDa crystal protein, Pesticidal crystal protein Cry1Fb

Promotes colloidosmotic lysis by binding to the midgut epithelial cells of insects. Cry1Fb Protein, Bacillus thuringiensis subsp., Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 26.3 kDa and the accession number is O66377.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
Cry1Fb Protein, Bacillus thuringiensis subsp., Recombinant (His)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 284.00
100 μg 20 days $ 537.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Promotes colloidosmotic lysis by binding to the midgut epithelial cells of insects. Cry1Fb Protein, Bacillus thuringiensis subsp., Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 26.3 kDa and the accession number is O66377.
Species Bacillus thuringiensis subsp. morrisoni
Expression System E. coli
Tag N-6xHis
Accession Number O66377
Synonyms cryIF(b), Crystaline entomocidal protoxin, Insecticidal delta-endotoxin CryIF(b), cryINA67-1, cry1Fb, 132 kDa crystal protein, Pesticidal crystal protein Cry1Fb
Amino Acid VKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEVDNNTDELKFSSNCEKEQVYPGNTVACNDYNKNHGANACSSRNGGYDESYESNSSIPADYAPVYEEEAYTDGQRGNPCEFNRGHTPLPAGYVTAELEYFPETDTVWVEIGETEGTFIVDSVELLLMEE
Construction 984-1169 aa
Protein Purity > 85% as determined by SDS-PAGE.
Molecular Weight 26.3 kDa (predicted)
Formulation Tris-based buffer, 50% glycerol
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted protein solutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Research Background Promotes colloidosmotic lysis by binding to the midgut epithelial cells of insects.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

Cry1Fb Protein, Bacillus thuringiensis subsp., Recombinant (His) cryIF(b) Crystaline entomocidal protoxin Insecticidal delta-endotoxin CryIF(b) cryINA67-1 cry1Fb 132 kDa crystal protein Pesticidal crystal protein Cry1Fb recombinant recombinant-proteins proteins protein

 

TargetMol