CPG2 Protein, Pseudomonas sp., Recombinant (GST)

Name: CPG2 Protein, Pseudomonas sp., Recombinant (GST)
Brand: TargetMol
SKU: TMPH-03190
Rating: 4.5 (1 reviews)

(Synonyms: Pteroylmonoglutamic acid hydrolase G2, Glutamate carboxypeptidase, Folate hydrolase G2, cpg2, CPDG2, Carboxypeptidase G2) Copy Product Info

Synonyms: Pteroylmonoglutamic acid hydrolase G2, Glutamate carboxypeptidase, Folate hydrolase G2, cpg2, CPDG2, Carboxypeptidase G2

Catalog No. TMPH-03190 Copy Product Info

Catalyzes the hydrolysis of reduced and non-reduced folates to pteroates and L-glutamate. This enzyme has a broad specificity. CPG2 Protein, Pseudomonas sp., Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 68.7 kDa and the accession number is P06621.

CPG2 Protein, Pseudomonas sp., Recombinant (GST)

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$129	20 days	20 days
10 µg	$216	20 days	20 days
20 µg	$360	-	In Stock
50 µg	$543	20 days	20 days
100 µg	$745	20 days	20 days
200 µg	$1,070	20 days	20 days
500 µg	$1,730	20 days	20 days
1 mg	$2,530	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:90%

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Catalyzes the hydrolysis of reduced and non-reduced folates to pteroates and L-glutamate. This enzyme has a broad specificity. CPG2 Protein, Pseudomonas sp., Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 68.7 kDa and the accession number is P06621.
Species	Pseudomonas
Expression System	E. coli
Tag	N-GST
Accession Number	P06621
Amino Acid	ALAQKRDNVLFQAATDEQPAVIKTLEKLVNIETGTGDAEGIAAAGNFLEAELKNLGFTVTRSKSAGLVVGDNIVGKIKGRGGKNLLLMSHMDTVYLKGILAKAPFRVEGDKAYGPGIADDKGGNAVILHTLKLLKEYGVRDYGTITVLFNTDEEKGSFGSRDLIQEEAKLADYVLSFEPTSAGDEKLSLGTSGIAYVQVNITGKASHAGAAPELGVNALVEASDLVLRTMNIDDKAKNLRFNWTIAKAGNVSNIIPASATLNADVRYARNEDFDAAMKTLEERAQQKKLPEADVKVIVTRGRPAFNAGEGGKKLVDKAVAYYKEAGGTLGVEERTGGGTDAAYAALSGKPVIESLGLPGFGYHSDKAEYVDISAIPRRLYMAARLIMDLGAGK
Construction	23-415 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Pteroylmonoglutamic acid hydrolase G2, Glutamate carboxypeptidase, Folate hydrolase G2, cpg2, CPDG2, Carboxypeptidase G2
Research Background	Catalyzes the hydrolysis of reduced and non-reduced folates to pteroates and L-glutamate. This enzyme has a broad specificity.

Chemical Properties

Molecular Weight

68.7 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.