Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

CPG2 Protein, Pseudomonas sp., Recombinant (GST)

Catalog No. TMPH-03190

Catalyzes the hydrolysis of reduced and non-reduced folates to pteroates and L-glutamate. This enzyme has a broad specificity. CPG2 Protein, Pseudomonas sp., Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 68.7 kDa and the accession number is P06621.

CPG2 Protein, Pseudomonas sp., Recombinant (GST)

CPG2 Protein, Pseudomonas sp., Recombinant (GST)

Catalog No. TMPH-03190
Catalyzes the hydrolysis of reduced and non-reduced folates to pteroates and L-glutamate. This enzyme has a broad specificity. CPG2 Protein, Pseudomonas sp., Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 68.7 kDa and the accession number is P06621.
Pack SizePriceAvailabilityQuantity
20 μg$360In Stock
100 μg$74520 days
1 mg$2,53020 days
Bulk & Custom
Add to Cart
Questions
View More
Select Batch
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Catalyzes the hydrolysis of reduced and non-reduced folates to pteroates and L-glutamate. This enzyme has a broad specificity. CPG2 Protein, Pseudomonas sp., Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 68.7 kDa and the accession number is P06621.
Species
Pseudomonas
Expression System
E. coli
TagN-GST
Accession NumberP06621
Synonyms
Pteroylmonoglutamic acid hydrolase G2,Glutamate carboxypeptidase,Folate hydrolase G2,cpg2,CPDG2,Carboxypeptidase G2
Amino Acid
ALAQKRDNVLFQAATDEQPAVIKTLEKLVNIETGTGDAEGIAAAGNFLEAELKNLGFTVTRSKSAGLVVGDNIVGKIKGRGGKNLLLMSHMDTVYLKGILAKAPFRVEGDKAYGPGIADDKGGNAVILHTLKLLKEYGVRDYGTITVLFNTDEEKGSFGSRDLIQEEAKLADYVLSFEPTSAGDEKLSLGTSGIAYVQVNITGKASHAGAAPELGVNALVEASDLVLRTMNIDDKAKNLRFNWTIAKAGNVSNIIPASATLNADVRYARNEDFDAAMKTLEERAQQKKLPEADVKVIVTRGRPAFNAGEGGKKLVDKAVAYYKEAGGTLGVEERTGGGTDAAYAALSGKPVIESLGLPGFGYHSDKAEYVDISAIPRRLYMAARLIMDLGAGK
Construction
23-415 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight68.7 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Catalyzes the hydrolysis of reduced and non-reduced folates to pteroates and L-glutamate. This enzyme has a broad specificity.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords