Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

CPG2 Protein, Pseudomonas sp., Recombinant (GST)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03190 Copy Product Info
Catalyzes the hydrolysis of reduced and non-reduced folates to pteroates and L-glutamate. This enzyme has a broad specificity. CPG2 Protein, Pseudomonas sp., Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 68.7 kDa and the accession number is P06621.

CPG2 Protein, Pseudomonas sp., Recombinant (GST)

Catalog No. TMPH-03190
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

Catalyzes the hydrolysis of reduced and non-reduced folates to pteroates and L-glutamate. This enzyme has a broad specificity. CPG2 Protein, Pseudomonas sp., Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 68.7 kDa and the accession number is P06621.

CPG2 Protein, Pseudomonas sp., Recombinant (GST)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$12920 days20 days
10 μg$21620 days20 days
20 μg$360-In Stock
50 μg$54320 days20 days
100 μg$74520 days20 days
200 μg$1,07020 days20 days
500 μg$1,73020 days20 days
1 mg$2,53020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Select Batch

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Catalyzes the hydrolysis of reduced and non-reduced folates to pteroates and L-glutamate. This enzyme has a broad specificity. CPG2 Protein, Pseudomonas sp., Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 68.7 kDa and the accession number is P06621.
Species
Pseudomonas
Expression System
E. coli
TagN-GST
Accession NumberP06621
Synonyms
Pteroylmonoglutamic acid hydrolase G2,Glutamate carboxypeptidase,Folate hydrolase G2,cpg2,CPDG2,Carboxypeptidase G2
Amino Acid
ALAQKRDNVLFQAATDEQPAVIKTLEKLVNIETGTGDAEGIAAAGNFLEAELKNLGFTVTRSKSAGLVVGDNIVGKIKGRGGKNLLLMSHMDTVYLKGILAKAPFRVEGDKAYGPGIADDKGGNAVILHTLKLLKEYGVRDYGTITVLFNTDEEKGSFGSRDLIQEEAKLADYVLSFEPTSAGDEKLSLGTSGIAYVQVNITGKASHAGAAPELGVNALVEASDLVLRTMNIDDKAKNLRFNWTIAKAGNVSNIIPASATLNADVRYARNEDFDAAMKTLEERAQQKKLPEADVKVIVTRGRPAFNAGEGGKKLVDKAVAYYKEAGGTLGVEERTGGGTDAAYAALSGKPVIESLGLPGFGYHSDKAEYVDISAIPRRLYMAARLIMDLGAGK
Construction
23-415 aa
Protein Purity
> 90% as determined by SDS-PAGE.
CPG2 Protein, Pseudomonas sp., Recombinant (GST)
Molecular Weight68.7 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Catalyzes the hydrolysis of reduced and non-reduced folates to pteroates and L-glutamate. This enzyme has a broad specificity.

Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords