Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Colicin-E5 Protein, E. coli, Recombinant (His & SUMO)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-00598 Copy Product Info
Colicins are polypeptide toxins produced by and active against E.coli and closely related bacteria. This colicin is an endonuclease. Colicin-E5 Protein, E. coli, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 24.8 kDa and the accession number is P18000.

Colicin-E5 Protein, E. coli, Recombinant (His & SUMO)

Catalog No. TMPH-00598
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

Colicins are polypeptide toxins produced by and active against E.coli and closely related bacteria. This colicin is an endonuclease. Colicin-E5 Protein, E. coli, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 24.8 kDa and the accession number is P18000.

Colicin-E5 Protein, E. coli, Recombinant (His & SUMO)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$27620 days20 days
10 μg$46320 days20 days
20 μg$78020 days20 days
50 μg$98720 days20 days
100 μg$1,26020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Colicins are polypeptide toxins produced by and active against E.coli and closely related bacteria. This colicin is an endonuclease. Colicin-E5 Protein, E. coli, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 24.8 kDa and the accession number is P18000.
Species
E. coli
Expression System
E. coli
TagN-6xHis-SUMO
Accession NumberP18000
Synonyms
Colicin-E5,col
Amino Acid
LAKNKGKIPGLKIDQKIRGQMPERGWTEDDIKNTVSNGATGTSFDKRSPKKTPPDYLGRNDPATVYGSPGKYVVVNDRTGEVTQISDKTDPGWVDDSRIQWGNKNDQ
Construction
74-180 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight24.8 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Colicins are polypeptide toxins produced by and active against E.coli and closely related bacteria. This colicin is an endonuclease.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords