Shopping Cart

Your shopping cart is currently empty

CNR1 Protein-VLP, Human, Recombinant (His)

Name: CNR1 Protein-VLP, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-01035
Rating: 4.5 (1 reviews)

(Synonyms: CNR1, CNR, CB-R, CB1, Cannabinoid receptor 1, CANN6) Copy Product Info

Synonyms: CNR1, CNR, CB-R, CB1, Cannabinoid receptor 1, CANN6

Catalog No. TMPH-01035 Copy Product Info

CNR1 Protein-VLP, Human, Recombinant (His) is expressed in HEK293 mammalian cells with C-10xHis tag. The predicted molecular weight is 54.6 kDa and the accession number is P21554.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 μg	$275	20 days	20 days
10 μg	$459	20 days	20 days
20 μg	$776	20 days	20 days
50 μg	$1,270	20 days	20 days
100 μg	$1,870	20 days	20 days
200 μg	$3,150	20 days	20 days
500 μg	$6,280	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:Less than 1.0 EU/ug as determined by LAL method

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity


Description	CNR1 Protein-VLP, Human, Recombinant (His) is expressed in HEK293 mammalian cells with C-10xHis tag. The predicted molecular weight is 54.6 kDa and the accession number is P21554.
Species	Human
Expression System	HEK293 Cells
Tag	C-10xHis (This tag can be tested only under denaturing conditions)
Accession Number	P21554
Amino Acid	MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVFHRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL
Construction	1-472 aa
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a solution filtered through a 0.22 μm filter, containing PBS, 6% Trehalose, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	CNR1, CNR, CB-R, CB1, Cannabinoid receptor 1, CANN6
Research Background

Chemical Properties

Molecular Weight

54.6 kDa (predicted)

Storage & Solubility Information

Storage

Store at low temperature Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

CNR 1CB 1CANN 6

Related Tags: CNR1 Protein-VLP, Human, Recombinant (His) chemical structure | CNR1 Protein-VLP, Human, Recombinant (His) molecular weight