Home Tools
Log in
Cart

CLECL1P Protein, Human, Recombinant (His & Myc)

Catalog No. TMPH-01984
Synonyms: Putative C-type lectin-like domain family 1, DC-associated lectin-1, CLECL1P, DCAL1, Dendritic cell-associated lectin 1, C-type lectin-like domain family 1 pseudogene, DCAL-1, CLECL1

May function in mediating immune cell-cell interactions. May act as a T-cell costimulatory molecule, enhancing anti-CD3-induced proliferation. May play a role in the interaction of dendritic cells with T-cells and the cells of the adaptive immune response. CLECL1P Protein, Human, Recombinant (His & Myc) is expressed in Baculovirus insect cells with N-10xHis and C-Myc tag. The predicted molecular weight is 13 kDa and the accession number is Q8IZS7.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
CLECL1P Protein, Human, Recombinant (His & Myc)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 491.00
100 μg 20 days $ 1,370.00
500 μg 20 days $ 1,960.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description May function in mediating immune cell-cell interactions. May act as a T-cell costimulatory molecule, enhancing anti-CD3-induced proliferation. May play a role in the interaction of dendritic cells with T-cells and the cells of the adaptive immune response. CLECL1P Protein, Human, Recombinant (His & Myc) is expressed in Baculovirus insect cells with N-10xHis and C-Myc tag. The predicted molecular weight is 13 kDa and the accession number is Q8IZS7.
Species Human
Expression System Baculovirus Insect Cells
Tag N-10xHis, C-Myc
Accession Number Q8IZS7
Synonyms Putative C-type lectin-like domain family 1, DC-associated lectin-1, CLECL1P, DCAL1, Dendritic cell-associated lectin 1, C-type lectin-like domain family 1 pseudogene, DCAL-1, CLECL1
Amino Acid KTVRTSPLELAFPLQRSVSFNFSTVHKSCPAKDWKVHKGKCYWIAETKKSWNKSQNDCAINNSYLMVIQDITAMVRFNI
Construction 89-167 aa
Protein Purity > 85% as determined by SDS-PAGE.
Molecular Weight 13 kDa (predicted)
Formulation If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Research Background May function in mediating immune cell-cell interactions. May act as a T-cell costimulatory molecule, enhancing anti-CD3-induced proliferation. May play a role in the interaction of dendritic cells with T-cells and the cells of the adaptive immune response.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

CLECL1P Protein, Human, Recombinant (His & Myc) Putative C-type lectin-like domain family 1 DC-associated lectin-1 CLECL1P DCAL1 Dendritic cell-associated lectin 1 C-type lectin-like domain family 1 pseudogene DCAL-1 CLECL1 recombinant recombinant-proteins proteins protein

 

TargetMol