Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

CHS1 Protein, S. cerevisiae, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03438 Copy Product Info
Polymerizes chitin, a structural polymer of the cell wall and septum, by transferring the sugar moiety of UDP-GlcNAc to the non-reducing end of the growing chitin polymer. Required for mitotic division septum formation during adverse conditions. CHS1 Protein, S. cerevisiae, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 26.6 kDa and the accession number is P08004.

CHS1 Protein, S. cerevisiae, Recombinant (His)

Catalog No. TMPH-03438
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

Polymerizes chitin, a structural polymer of the cell wall and septum, by transferring the sugar moiety of UDP-GlcNAc to the non-reducing end of the growing chitin polymer. Required for mitotic division septum formation during adverse conditions. CHS1 Protein, S. cerevisiae, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 26.6 kDa and the accession number is P08004.

CHS1 Protein, S. cerevisiae, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$5020 days20 days
10 μg$7820 days20 days
20 μg$11520 days20 days
50 μg$19820 days20 days
100 μg$38820 days20 days
200 μg$63920 days20 days
500 μg$1,07020 days20 days
1 mg$1,68020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Polymerizes chitin, a structural polymer of the cell wall and septum, by transferring the sugar moiety of UDP-GlcNAc to the non-reducing end of the growing chitin polymer. Required for mitotic division septum formation during adverse conditions. CHS1 Protein, S. cerevisiae, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 26.6 kDa and the accession number is P08004.
Species
Saccharomyces cerevisiae
Expression System
E. coli
TagN-6xHis
Accession NumberP08004
Synonyms
CHS1,Chitin-UDP acetyl-glucosaminyl transferase 1,Chitin synthase 1
Amino Acid
QNNRSRNEYHSNRKNEPSYELQNAHSGLFHSSNEELTNRNQRYTNQNASMGSFTPVQSLQFPEQSQQTNMLYNGDDGNNNTINDNERDIYGGFVNHHRQRPPPATAEYNDVFNTNSQQLPSEHQYNNVPSYPLPSINVIQTTPELIHNGSQTMATPIERPFFNENDYYYNNRNSRTSPSIASSSDGYADQEARPILE
Construction
4-200 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight26.6 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Polymerizes chitin, a structural polymer of the cell wall and septum, by transferring the sugar moiety of UDP-GlcNAc to the non-reducing end of the growing chitin polymer. Required for mitotic division septum formation during adverse conditions.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords