Home Tools
Log in
Cart

Chitin-binding lectin Protein, Viscum album, Recombinant (His)

Catalog No. TMPH-03708
Synonyms: Chitin-binding lectin

Chitin-binding lectin which is specific for N-acetylglucosamine oligomers. Chitin-binding lectin Protein, Viscum album, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 11.4 kDa and the accession number is P81859.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
Chitin-binding lectin Protein, Viscum album, Recombinant (His)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 360.00
100 μg 20 days $ 678.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Chitin-binding lectin which is specific for N-acetylglucosamine oligomers. Chitin-binding lectin Protein, Viscum album, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 11.4 kDa and the accession number is P81859.
Species Viscum album
Expression System E. coli
Tag N-6xHis
Accession Number P81859
Synonyms Chitin-binding lectin
Amino Acid IDHRCGREATPPGKLCNDGRCCSQWGWCGTTQAYCSGKCQSQCDCNRDL
Construction 1-49 aa
Protein Purity > 85% as determined by SDS-PAGE.
Molecular Weight 11.4 kDa (predicted)
Formulation If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Research Background Chitin-binding lectin which is specific for N-acetylglucosamine oligomers.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

Chitin-binding lectin Protein, Viscum album, Recombinant (His) Chitin-binding lectin recombinant recombinant-proteins proteins protein

 

TargetMol