CES1C Protein, Mouse, Recombinant (His & Myc)

Name: CES1C Protein, Mouse, Recombinant (His & Myc)
Brand: TargetMol
SKU: TMPH-02562
Rating: 4.5 (1 reviews)

(Synonyms: PES-N, Lung surfactant convertase, Liver carboxylesterase N, Es1, Ces1c, Carboxylesterase 1C) Copy Product Info

Synonyms: PES-N, Lung surfactant convertase, Liver carboxylesterase N, Es1, Ces1c, Carboxylesterase 1C

Catalog No. TMPH-02562 Copy Product Info

Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs. Involved in the extracellular metabolism of lung surfactant.

CES1C Protein, Mouse, Recombinant (His & Myc)

Pack Size	Price	USA Stock	Global Stock
5 μg	$219	20 days	20 days
10 μg	$365	20 days	20 days
20 μg	$613	20 days	20 days
50 μg	$1,160	20 days	20 days
100 μg	$1,890	20 days	20 days
200 μg	$2,890	20 days	20 days
500 μg	$5,160	20 days	20 days
1 mg	$7,960	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity


Description	Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs. Involved in the extracellular metabolism of lung surfactant.
Species	Mouse
Expression System	HEK293 Cells
Tag	N-10xHis, C-Myc
Accession Number	P23953
Amino Acid	HSLLPPVVDTTQGKVLGKYISLEGFEQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNATSYPPMCSQDAGWAKILSDMFSTEKEILPLKISEDCLYLNIYSPADLTKSSQLPVMVWIHGGGLVIGGASPYNGLALSAHENVVVVTIQYRLGIWGLFSTGDEHSPGNWAHLDQLAALRWVQDNIANFGGNPDSVTIFGESSGGISVSVLVLSPLGKDLFHRAISESGVVINTNVGKKNIQAVNEIIATLSQCNDTSSAAMVQCLRQKTESELLEISGKLVQYNISLSTMIDGVVLPKAPEEILAEKSFNTVPYIVGFNKQEFGWIIPMMLQNLLPEGKMNEETASLLLRRFHSELNISESMIPAVIEQYLRGVDDPAKKSELILDMFGDIFFGIPAVLLSRSLRDAGVSTYMYEFRYRPSFVSDKRPQTVEGDHGDEIFFVFGAPLLKEGASEEETNLSKMVMKFWANFARNGNPNGEGLPHWPEYDEQEGYLQIGATTQQAQRLKAEEVAFWTELLAKNPPETDPTEH
Construction	19-550 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	PES-N, Lung surfactant convertase, Liver carboxylesterase N, Es1, Ces1c, Carboxylesterase 1C
Research Background

Chemical Properties

Molecular Weight

63.6 kDa (predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

Es 1Carboxylesterase1C

Related Tags: CES1C Protein, Mouse, Recombinant (His & Myc) chemical structure | CES1C Protein, Mouse, Recombinant (His & Myc) molecular weight