CEMP1 Protein, Human, Recombinant (His)

Name: CEMP1 Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-01076
Rating: 4.5 (1 reviews)

(Synonyms: CEMP1, Cementum protein 23 (CP-23), Cementum protein 1, Cementoblastoma-derived protein 1) Copy Product Info

Synonyms: CEMP1, Cementum protein 23 (CP-23), Cementum protein 1, Cementoblastoma-derived protein 1

Catalog No. TMPH-01076 Copy Product Info

May play a role in development of the periodontium which surrounds and supports the teeth by promoting the differentiation of multi-potent cells from the periodontal ligament into cementoblasts to form the cementum. Binds hydroxyapatite and may promote the biomineralization of the cementum. Also promotes cell proliferation. CEMP1 Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 28.0 kDa and the accession number is Q6PRD7.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 μg	$86	20 days	20 days
10 μg	$138	20 days	20 days
20 μg	$231	20 days	20 days
50 μg	$348	20 days	20 days
100 μg	$480	20 days	20 days
200 μg	$743	20 days	20 days
500 μg	$1,330	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity


Description	May play a role in development of the periodontium which surrounds and supports the teeth by promoting the differentiation of multi-potent cells from the periodontal ligament into cementoblasts to form the cementum. Binds hydroxyapatite and may promote the biomineralization of the cementum. Also promotes cell proliferation. CEMP1 Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 28.0 kDa and the accession number is Q6PRD7.
Species	Human
Expression System	P. pastoris (Yeast)
Tag	N-6xHis
Accession Number	Q6PRD7
Amino Acid	MGTSSTDSQQAGHRRCSTSNTSAENLTCLSLPGSPGKTAPLPGPAQAGAGQPLPKGCAAVKAEVGIPAPHTSQEVRIHIRRLLSWAAPGACGLRSTPCALPQALPQARPCPGRWFFPGCSLPTGGAQTILSLWTWRHFLNWALQQREENSGRARRVPPVPRTAPVSKGEGSHPPQNSNGEKVKTITPDVGLHQSLTSDPTVAVLRAKRAPEAHPPRSCSGSLTARVCHMGVCQGQGDTEDGRMTLMG
Construction	1-247 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	CEMP1, Cementum protein 23 (CP-23), Cementum protein 1, Cementoblastoma-derived protein 1
Research Background

Chemical Properties

Molecular Weight

28.0 kDa (predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

CP-23CP23CEMP 1Cementum protein1

Related Tags: CEMP1 Protein, Human, Recombinant (His) chemical structure | CEMP1 Protein, Human, Recombinant (His) molecular weight