Home Tools
Log in
Cart

CELA2A Protein, Mouse, Recombinant (His)

Catalog No. TMPH-02582
Synonyms: Elastase-2A, ELA2A, CELA2A, Chymotrypsin-like elastase family member 2A

Elastase that enhances insulin signaling and might have a physiologic role in cellular glucose metabolism. Circulates in plasma and reduces platelet hyperactivation, triggers both insulin secretion and degradation, and increases insulin sensitivity. CELA2A Protein, Mouse, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 29.7 kDa and the accession number is P05208.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
CELA2A Protein, Mouse, Recombinant (His)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 284.00
100 μg 20 days $ 537.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Elastase that enhances insulin signaling and might have a physiologic role in cellular glucose metabolism. Circulates in plasma and reduces platelet hyperactivation, triggers both insulin secretion and degradation, and increases insulin sensitivity. CELA2A Protein, Mouse, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 29.7 kDa and the accession number is P05208.
Species Mouse
Expression System E. coli
Tag N-6xHis
Accession Number P05208
Synonyms Elastase-2A, ELA2A, CELA2A, Chymotrypsin-like elastase family member 2A
Amino Acid VVGGQEATPNTWPWQVSLQVLSSGRWRHNCGGSLVANNWVLTAAHCLSNYQTYRVLLGAHSLSNPGAGSAAVQVSKLVVHQRWNSQNVGNGYDIALIKLASPVTLSKNIQTACLPPAGTILPRNYVCYVTGWGLLQTNGNSPDTLRQGRLLVVDYATCSSASWWGSSVKSSMVCAGGDGVTSSCNGDSGGPLNCRASNGQWQVHGIVSFGSSLGCNYPRKPSVFTRVSNYIDWINSVMARN
Construction 31-271 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 29.7 kDa (predicted)
Formulation Tris-based buffer, 50% glycerol
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Research Background Elastase that enhances insulin signaling and might have a physiologic role in cellular glucose metabolism. Circulates in plasma and reduces platelet hyperactivation, triggers both insulin secretion and degradation, and increases insulin sensitivity.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

CELA2A Protein, Mouse, Recombinant (His) Elastase-2A ELA2A CELA2A Chymotrypsin-like elastase family member 2A recombinant recombinant-proteins proteins protein

 

TargetMol