CDKN2B Protein, Human, Recombinant (His & Myc)

Name: CDKN2B Protein, Human, Recombinant (His & Myc)
Brand: TargetMol
SKU: TMPH-01168
Rating: 4.5 (1 reviews)

(Synonyms: p15-INK4b (p15INK4B), p14-INK4b, Multiple tumor suppressor 2 (MTS-2), MTS2, Cyclin-dependent kinase 4 inhibitor B, CDKN2B) Copy Product Info

Synonyms: p15-INK4b (p15INK4B), p14-INK4b, Multiple tumor suppressor 2 (MTS-2), MTS2, Cyclin-dependent kinase 4 inhibitor B, CDKN2B

Catalog No. TMPH-01168 Copy Product Info

CDKN2B Protein, Human, Recombinant (His & Myc) is expressed in E. coli.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$105	20 days	20 days
10 µg	$169	20 days	20 days
20 µg	$283	20 days	20 days
50 µg	$428	20 days	20 days
100 µg	$590	20 days	20 days
200 µg	$913	20 days	20 days
500 µg	$1,620	20 days	20 days
1 mg	$2,530	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	CDKN2B Protein, Human, Recombinant (His & Myc) is expressed in E. coli.
Species	Human
Expression System	E. coli
Tag	N-10xHis, C-Myc
Accession Number	P42772
Amino Acid	MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD
Construction	1-138 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	p15-INK4b (p15INK4B), p14-INK4b, Multiple tumor suppressor 2 (MTS-2), MTS2, Cyclin-dependent kinase 4 inhibitor B, CDKN2B
Research Background	Interacts strongly with CDK4 and CDK6. Potent inhibitor. Potential effector of TGF-beta induced cell cycle arrest.

Chemical Properties

Molecular Weight

19.7 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.