CDK7 Protein, Human, Recombinant (His)

Name: CDK7 Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-01172
Rating: 4.5 (1 reviews)

(Synonyms: TFIIH basal transcription factor complex kinase subunit, STK1, Serine/threonine-protein kinase 1, MO15, Cyclin-dependent kinase 7, Cell division protein kinase 7, CDKN7, CDK-activating kinase 1, CDK7, CAK1, CAK, 39 kDa protein kinase (p39 Mo15)) Copy Product Info

Synonyms: TFIIH basal transcription factor complex kinase subunit, STK1, Serine/threonine-protein kinase 1, MO15, Cyclin-dependent kinase 7, Cell division protein kinase 7, CDKN7, CDK-activating kinase 1, CDK7, CAK1, CAK, 39 kDa protein kinase (p39 Mo15)

Catalog No. TMPH-01172 Copy Product Info

CDK7 Protein, Human, Recombinant (His) is expressed in Baculovirus.

Pack Size	Price	USA Stock	Global Stock
5 µg	$135	20 days	20 days
10 µg	$222	20 days	20 days
20 µg	$371	20 days	20 days
50 µg	$678	20 days	20 days
100 µg	$1,080	20 days	20 days
200 µg	$1,280	20 days	20 days
500 µg	$1,630	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	CDK7 Protein, Human, Recombinant (His) is expressed in Baculovirus.
Species	Human
Expression System	Baculovirus Insect Cells
Tag	N-10xHis
Accession Number	P50613
Amino Acid	MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF
Construction	1-346 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	TFIIH basal transcription factor complex kinase subunit, STK1, Serine/threonine-protein kinase 1, MO15, Cyclin-dependent kinase 7, Cell division protein kinase 7, CDKN7, CDK-activating kinase 1, CDK7, CAK1, CAK, 39 kDa protein kinase (p39 Mo15)
Research Background	Serine/threonine kinase involved in cell cycle control and in RNA polymerase II-mediated RNA transcription. Cyclin-dependent kinases (CDKs) are activated by the binding to a cyclin and mediate the progression through the cell cycle. Each different complex controls a specific transition between 2 subsequent phases in the cell cycle. Required for both activation and complex formation of CDK1/cyclin-B during G2-M transition, and for activation of CDK2/cyclins during G1-S transition (but not complex formation). CDK7 is the catalytic subunit of the CDK-activating kinase (CAK) complex. Phosphorylates SPT5/SUPT5H, SF1/NR5A1, POLR2A, p53/TP53, CDK1, CDK2, CDK4, CDK6 and CDK11B/CDK11. CAK activates the cyclin-associated kinases CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation, thus regulating cell cycle progression. CAK complexed to the core-TFIIH basal transcription factor activates RNA polymerase II by serine phosphorylation of the repetitive C-terminal domain (CTD) of its large subunit (POLR2A), allowing its escape from the promoter and elongation of the transcripts. Phosphorylation of POLR2A in complex with DNA promotes transcription initiation by triggering dissociation from DNA. Its expression and activity are constant throughout the cell cycle. Upon DNA damage, triggers p53/TP53 activation by phosphorylation, but is inactivated in turn by p53/TP53; this feedback loop may lead to an arrest of the cell cycle and of the transcription, helping in cell recovery, or to apoptosis. Required for DNA-bound peptides-mediated transcription and cellular growth inhibition.

Chemical Properties

Molecular Weight

41.5 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.