Home Tools
Log in
Cart

CDK7 Protein, Human, Recombinant (His)

Catalog No. TMPH-01172
Synonyms: 39 kDa protein kinase, Cyclin-dependent kinase 7, CDK-activating kinase 1, TFIIH basal transcription factor complex kinase subunit, CAK, p39 Mo15, MO15, STK1, CAK1, CDKN7, Serine/threonine-protein kinase 1, CDK7, Cell division protein kinase 7

CDK7 Protein, Human, Recombinant (His) is expressed in Baculovirus.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
CDK7 Protein, Human, Recombinant (His)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 371.00
100 μg 20 days $ 987.00
500 μg 20 days $ 1,490.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description CDK7 Protein, Human, Recombinant (His) is expressed in Baculovirus.
Species Human
Expression System Baculovirus
Tag N-terminal 10xHis-tagged
Accession Number P50613
Synonyms 39 kDa protein kinase, Cyclin-dependent kinase 7, CDK-activating kinase 1, TFIIH basal transcription factor complex kinase subunit, CAK, p39 Mo15, MO15, STK1, CAK1, CDKN7, Serine/threonine-protein kinase 1, CDK7, Cell division protein kinase 7
Amino Acid MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Construction 1-346 aa
Protein Purity > 85% as determined by SDS-PAGE.
Molecular Weight 41.5 kDa as predicted
Formulation If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage

Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shipping

In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise.

Research Background Serine/threonine kinase involved in cell cycle control and in RNA polymerase II-mediated RNA transcription. Cyclin-dependent kinases (CDKs) are activated by the binding to a cyclin and mediate the progression through the cell cycle. Each different complex controls a specific transition between 2 subsequent phases in the cell cycle. Required for both activation and complex formation of CDK1/cyclin-B during G2-M transition, and for activation of CDK2/cyclins during G1-S transition (but not complex formation). CDK7 is the catalytic subunit of the CDK-activating kinase (CAK) complex. Phosphorylates SPT5/SUPT5H, SF1/NR5A1, POLR2A, p53/TP53, CDK1, CDK2, CDK4, CDK6 and CDK11B/CDK11. CAK activates the cyclin-associated kinases CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation, thus regulating cell cycle progression. CAK complexed to the core-TFIIH basal transcription factor activates RNA polymerase II by serine phosphorylation of the repetitive C-terminal domain (CTD) of its large subunit (POLR2A), allowing its escape from the promoter and elongation of the transcripts. Phosphorylation of POLR2A in complex with DNA promotes transcription initiation by triggering dissociation from DNA. Its expression and activity are constant throughout the cell cycle. Upon DNA damage, triggers p53/TP53 activation by phosphorylation, but is inactivated in turn by p53/TP53; this feedback loop may lead to an arrest of the cell cycle and of the transcription, helping in cell recovery, or to apoptosis. Required for DNA-bound peptides-mediated transcription and cellular growth inhibition.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

CDK7 Protein, Human, Recombinant (His) 39 kDa protein kinase Cyclin-dependent kinase 7 CDK-activating kinase 1 TFIIH basal transcription factor complex kinase subunit CAK p39 Mo15 MO15 STK1 CAK1 CDKN7 Serine/threonine-protein kinase 1 CDK7 Cell division protein kinase 7 recombinant recombinant-proteins proteins protein

 

TargetMol