CD9 Protein-VLP, Mouse, Recombinant (His)

Catalog No. TMPH-04502

CD9 Protein-VLP, Mouse, Recombinant (His) is expressed in Mammalian cell. The accession number is P40240.

CD9 Protein-VLP, Mouse, Recombinant (His)

Catalog No. TMPH-04502

CD9 Protein-VLP, Mouse, Recombinant (His) is expressed in Mammalian cell. The accession number is P40240.

Pack Size	Price	Availability
5 μg	$297	20 days
10 μg	$512	20 days
20 μg	$863	20 days
50 μg	$1,350	20 days
100 μg	$1,900	20 days
200 μg	$3,190	20 days
500 μg	$6,350	20 days

Bulk & Custom

Add to Cart

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	CD9 Protein-VLP, Mouse, Recombinant (His) is expressed in Mammalian cell. The accession number is P40240.
Species	Mouse
Expression System	HEK293 Cells
Tag	C-10xHis
Accession Number	P40240
Synonyms	CD9 antigen,CD9,Cd9
Amino Acid	MPVKGGSKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQENNHSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAVWGYTHKDEVIKELQEFYKDTYQKLRSKDEPQRETLKAIHMALDCCGIAGPLEQFISDTCPKKQLLESFQVKPCPEAISEVFNNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRSREMV
Construction	1-226 aa
Protein Purity	The purity information is not available for VLPs proteins.
Molecular Weight	26.6 kDa (Predicted)
Endotoxin	Not tested.
Formulation	Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 139 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.