Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

CD9 Protein-VLP, Mouse, Recombinant (His)

TargetMol | SPR
Catalog No. TMPH-04502 Copy Product Info
CD9 Protein-VLP, Mouse, Recombinant (His) is expressed in Mammalian cell. The accession number is P40240.

CD9 Protein-VLP, Mouse, Recombinant (His)

Catalog No. TMPH-04502
Copy Product Info
TargetMol | SPR

CD9 Protein-VLP, Mouse, Recombinant (His) is expressed in Mammalian cell. The accession number is P40240.

CD9 Protein-VLP, Mouse, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$29720 days20 days
10 μg$51220 days20 days
20 μg$86320 days20 days
50 μg$1,35020 days20 days
100 μg$1,90020 days20 days
200 μg$3,19020 days20 days
500 μg$6,35020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
CD9 Protein-VLP, Mouse, Recombinant (His) is expressed in Mammalian cell. The accession number is P40240.
Species
Mouse
Expression System
HEK293 Cells
TagC-10xHis
Accession NumberP40240
Synonyms
CD9 antigen,Cd9
Amino Acid
MPVKGGSKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQENNHSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAVWGYTHKDEVIKELQEFYKDTYQKLRSKDEPQRETLKAIHMALDCCGIAGPLEQFISDTCPKKQLLESFQVKPCPEAISEVFNNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRSREMV
Construction
1-226 aa
Protein Purity
The purity information is not available for VLPs proteins.
Molecular Weight26.6 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 139 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords